KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_2217Help
Entry
Rhom172_2217      CDS       T01606                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
rmg00340  Histidine metabolism
rmg01100  Metabolic pathways
rmg01110  Biosynthesis of secondary metabolites
rmg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Rhom172_2217
Enzymes [BR:rmg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Rhom172_2217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh LpxD
Motif
Other DBs
NCBI-ProteinID: AEN74116
UniProt: G2SI60
Position
complement(2528051..2529382)
Genome map
AA seq 443 aa AA seqDB search
MELLPIVPYEQRAERLAALWTRGGTFDPEVERAVQEILQQVQQQGDAALLALTERFDGVR
PPSLRVPEAELAAAYETMDPELKAIIAEAVDNIRRFHEHQRRTSWFVEDGDGVVLGQRIV
PLERVGLYVPGGRAFYPSSLLMNAIPAQVAGVPELHLVSPPGPSGWPHPLVLATAHFLGI
RHVYAVGGAQAVAALAFGTETIPRVDKIVGPGNAYVALAKKMVFGRVDIDAVAGPSEIVV
LADDTADPEFVAADLLSQAEHDERASAVLVTPHALLAEAVRARVQRMVAEAPRRAILEAS
LARYGACIVTPSMTEAYAVVNELAPEHLELIVRDPWAALPHIRHAGAIFLGPFSTEPVGD
YFAGPNHVLPTGGTARYASALSVDDFVRSQSIIAYTAERLRRTGPRIMRFAEAEALPAHA
QAVAVRLARLAEQAPDSAVRSSA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggaactgcttcccatcgttccctacgagcagcgcgccgagcgactggcggcgctctgg
acgcgcggcggcacgttcgatccggaagtggagcgggccgtgcaggagatcctgcagcag
gtgcaacagcagggcgacgccgcgctgctggcgctgaccgaacggtttgacggggtacgt
ccgccatcgctccgggtgccggaagcggagctggcggcggcctacgagaccatggacccc
gagctgaaggccatcattgccgaagcggtcgacaacatccggcgcttccacgagcatcag
cggcgcacctcgtggttcgtcgaggacggcgacggcgtggtgctgggccagcggattgtg
ccgctggagcgggtgggactctacgtgccgggcggccgcgcattctacccgtccagcctg
ctgatgaacgcgattccggcccaggtggccggcgtgccggagctacatctggtgtcgccg
ccggggccttccggatggccgcatccgctggtgctggccacggcccactttctgggcatt
cggcatgtgtacgccgtgggcggggcgcaggccgtggcggcgctggccttcggaacggag
acgattccgcgcgtggacaagatcgtggggccggggaatgcctacgtggcgctggccaag
aaaatggttttcggccgggtggacattgatgccgtggccggtcccagcgagatcgtggtg
ctggccgacgacacggccgatccagaattcgtggcggccgacctgctctcgcaggccgag
cacgacgagcgggcttcggccgtgctggttacacctcacgcgctgctggccgaggcggtc
cgggcgcgtgtgcaacgcatggtggccgaagcgccccgccgcgccattctggaggcgtcg
ctggcacgctacggcgcctgcatcgtgacgccgtcgatgaccgaggcgtacgcggtggtc
aacgagctggcgcccgaacacctggagctgatcgtgcgggacccctgggcggcgttgccg
cacatccgccatgcaggggccatctttctggggccgttttcgacggagccggtgggcgac
tacttcgccggacccaaccatgtgctgcccaccgggggcacggcccgctacgcctcggcg
ctgagtgtggacgacttcgtgcggagccagtcgatcatcgcctacacggccgagcggctg
cgccggaccggtccgcgtatcatgcgcttcgccgaggccgaggcgctgcccgcgcacgcc
caggcggtggccgtccggctggcccgcctggcggaacaagcgccggactccgccgtgcgt
tcgtctgcctga

DBGET integrated database retrieval system