KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_2217Help
Entry
Rhom172_2217      CDS       T01606                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rmg01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:rmg00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2528051..2529382)
Genome map
AA seq 443 aa AA seqDB search
MELLPIVPYEQRAERLAALWTRGGTFDPEVERAVQEILQQVQQQGDAALLALTERFDGVR
PPSLRVPEAELAAAYETMDPELKAIIAEAVDNIRRFHEHQRRTSWFVEDGDGVVLGQRIV
PLERVGLYVPGGRAFYPSSLLMNAIPAQVAGVPELHLVSPPGPSGWPHPLVLATAHFLGI
RHVYAVGGAQAVAALAFGTETIPRVDKIVGPGNAYVALAKKMVFGRVDIDAVAGPSEIVV
LADDTADPEFVAADLLSQAEHDERASAVLVTPHALLAEAVRARVQRMVAEAPRRAILEAS
LARYGACIVTPSMTEAYAVVNELAPEHLELIVRDPWAALPHIRHAGAIFLGPFSTEPVGD
YFAGPNHVLPTGGTARYASALSVDDFVRSQSIIAYTAERLRRTGPRIMRFAEAEALPAHA
QAVAVRLARLAEQAPDSAVRSSA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggaactgcttcccatcgttccctacgagcagcgcgccgagcgactggcggcgctctgg
acgcgcggcggcacgttcgatccggaagtggagcgggccgtgcaggagatcctgcagcag
gtgcaacagcagggcgacgccgcgctgctggcgctgaccgaacggtttgacggggtacgt
ccgccatcgctccgggtgccggaagcggagctggcggcggcctacgagaccatggacccc
gagctgaaggccatcattgccgaagcggtcgacaacatccggcgcttccacgagcatcag
cggcgcacctcgtggttcgtcgaggacggcgacggcgtggtgctgggccagcggattgtg
ccgctggagcgggtgggactctacgtgccgggcggccgcgcattctacccgtccagcctg
ctgatgaacgcgattccggcccaggtggccggcgtgccggagctacatctggtgtcgccg
ccggggccttccggatggccgcatccgctggtgctggccacggcccactttctgggcatt
cggcatgtgtacgccgtgggcggggcgcaggccgtggcggcgctggccttcggaacggag
acgattccgcgcgtggacaagatcgtggggccggggaatgcctacgtggcgctggccaag
aaaatggttttcggccgggtggacattgatgccgtggccggtcccagcgagatcgtggtg
ctggccgacgacacggccgatccagaattcgtggcggccgacctgctctcgcaggccgag
cacgacgagcgggcttcggccgtgctggttacacctcacgcgctgctggccgaggcggtc
cgggcgcgtgtgcaacgcatggtggccgaagcgccccgccgcgccattctggaggcgtcg
ctggcacgctacggcgcctgcatcgtgacgccgtcgatgaccgaggcgtacgcggtggtc
aacgagctggcgcccgaacacctggagctgatcgtgcgggacccctgggcggcgttgccg
cacatccgccatgcaggggccatctttctggggccgttttcgacggagccggtgggcgac
tacttcgccggacccaaccatgtgctgcccaccgggggcacggcccgctacgcctcggcg
ctgagtgtggacgacttcgtgcggagccagtcgatcatcgcctacacggccgagcggctg
cgccggaccggtccgcgtatcatgcgcttcgccgaggccgaggcgctgcccgcgcacgcc
caggcggtggccgtccggctggcccgcctggcggaacaagcgccggactccgccgtgcgt
tcgtctgcctga

DBGET integrated database retrieval system