KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_2331Help
Entry
Rhom172_2331      CDS       T01606                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
rmg00010  Glycolysis / Gluconeogenesis
rmg00030  Pentose phosphate pathway
rmg00051  Fructose and mannose metabolism
rmg00052  Galactose metabolism
rmg00680  Methane metabolism
rmg01100  Metabolic pathways
rmg01110  Biosynthesis of secondary metabolites
rmg01120  Microbial metabolism in diverse environments
rmg01130  Biosynthesis of antibiotics
rmg01200  Carbon metabolism
rmg01230  Biosynthesis of amino acids
rmg03018  RNA degradation
Module
rmg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rhom172_2331
   00030 Pentose phosphate pathway
    Rhom172_2331
   00051 Fructose and mannose metabolism
    Rhom172_2331
   00052 Galactose metabolism
    Rhom172_2331
  Energy metabolism
   00680 Methane metabolism
    Rhom172_2331
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Rhom172_2331
Enzymes [BR:rmg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Rhom172_2331
Protein phosphatases and associated proteins [BR:rmg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Rhom172_2331
Messenger RNA biogenesis [BR:rmg03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Rhom172_2331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: AEN74225
UniProt: G2SJQ7
Position
complement(2659995..2660978)
Genome map
AA seq 327 aa AA seqDB search
MEEIRRIGVFTSGGDAPGMNACIRAVVRTAIAHDLEVVGIRRGYAGMIEGDFVEMDGRSV
SNILQLGGTILKSARSKAFMTPEGRAKAAEQLRKAGIDALVAIGGDGTFRGAAVFYEEHH
IPIVGCPGTIDNDLFGTDETIGFDTAMNTAIQNIDRIRDTADAHDRLFLVEVMGRDAGFI
ALNCGIGSGAEMVLIPETFTDIEEIKERILSLMSAQSRSSIVVVAEGDEHGGAMQIAQDL
REDPAFARIDLRVCILGHTQRGGSPTARDRVLASRLGAAAVEALLQGHSNVMVGVVNGEI
KLTPLKHVYSRKKTIDYELLKLTQLLG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaattcgacgtatcggggtcttcaccagcggtggcgatgcccccggcatgaac
gcctgcatccgggccgtggtgcgcacggccattgcccacgatctggaggtggtgggtatc
cggcgcggctatgccggcatgatcgagggcgactttgtggaaatggatggccgctccgtg
tcgaacatcctgcagctcggcggaaccattctcaaaagtgctcgctcgaaggccttcatg
acccccgaaggtcgggcgaaggcggccgagcagctccgaaaggccggcatcgatgcgctg
gtggccatcgggggcgatgggacgttccgtggggccgccgtcttttatgaggagcatcac
atcccgatcgtcgggtgcccgggcacgatcgacaacgacctgttcggcaccgacgagacg
atcggcttcgatacggccatgaatacggccattcagaacatcgaccgcatccgcgacacg
gccgatgcgcacgaccggctgtttctggtcgaggtgatgggacgtgacgccggcttcatc
gcgttgaactgtggcatcggcagcggggcggagatggtgctgatcccggagactttcacc
gacatcgaggagatcaaggagcggatcctttcgctgatgtcggcgcagtcccgttcgtcg
atcgtcgtggtggccgaaggcgacgagcacggcggcgccatgcagattgcgcaggatctg
cgtgaggatccggcctttgccaggatcgacctgcgggtgtgcatcttgggccatacgcag
cggggcggctcgcccacggcgcgtgaccgcgtgctggccagtcggctgggggcggcggcc
gtcgaagcgctgctgcagggacattccaacgtgatggtaggcgtggtcaacggcgagatc
aaactgacgccgctcaagcacgtctacagccgcaagaagacgatcgattacgagctgctc
aaactgacccagttgctgggctga

DBGET integrated database retrieval system