KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_2385Help
Entry
Rhom172_2385      CDS       T01606                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:rmg00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2715394..2717058)
Genome map
AA seq 554 aa AA seqDB search
MCSIVGCVASESSSVEETLFLLRHTRHRGPDAVGLYADGEVIQDVRLEGLAARVQGQKAR
ISLGHCRLEIVGGPAARQPMASCDGRLRLIHNGEIYNYQELRALLKGHRLQTRSDSEVLV
HLIETYYRGDLAEAVQAVLPLLDGMYAFAVTDGQAVVVARDPFGKKPVYFTPTWPVRFAS
EAKALVAHTSSVLRLPPGHLLVIQENEVQVRQGVTLERPPINIQEESEALEAYADAFDQA
IAKRTIGQRRVAVLLSGGVDSTLLAKALVDRGLEVTGYCVGQPEASDVQLVKRLARTLGL
SVHVTELTPELVAAELPEIIRAIEMNGPVQVGAAIPMYLATKAAARDGHRVLYSGQAADE
LFAGYDWYREVLQREGPLTLHARLWEDIDALYVDTLEREDRTSMAHSVELRAPFLDRDLL
RVAMRMDPRLKLPDAGAEGKWIHRRLAARRGVPEWIAFGAKVRAQDGASVGDVLEEVARQ
NLRSALPGKREMLCDYGSNYRYGVDPDSSPAIASLLYQVTRTHRIAIPRVQDAWPGSVSL
TRDRKARVVALTGN
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcgattgttggctgtgtagcctcggagtcgtcctctgttgaagaaaccctgttc
ttgctgcgacacacgcgtcatcgtggtccggatgcagtgggcctgtatgccgatggcgag
gtgattcaggacgtgcggttggaaggcctggccgcgcgtgtgcagggacagaaagcccgc
atcagtctgggacattgtcgactggaaattgtcggggggccggctgcgcgccagccgatg
gccagttgcgacgggcggttgcggctcatccataatggggaaatctataattatcaggag
ctgcgtgcgctgttgaagggacatcgtctgcagacccggagtgacagcgaggtgctggtc
cacttgatcgaaacctattacaggggagatctggccgaggcggtgcaggctgtgctgcca
ctgctcgatggcatgtatgcctttgcggtaacggacgggcaggcggtcgtagtggcccgt
gatcctttcgggaagaagccggtctatttcacgcctacctggccggtgcgttttgcttcg
gaagccaaggcactggtcgcgcacacgtcgtccgttctgcggttgccgcccgggcatttg
ctggttatccaggagaacgaagtgcaggtgcggcagggggtaacgctggagcgcccgccc
atcaacattcaagaggagagcgaggccctggaggcctatgccgacgcattcgatcaggcg
atcgccaaacgtacgatcggacagcggcgggtggccgtattgctttccggcggagtggac
agcacgttgctggccaaggcgctggtggatcggggcctggaggtgaccggctactgcgtg
gggcagcccgaggcctcggatgtgcaactggtgaaacggctggcgcgcacgctggggcta
tcggtgcacgtgacggaactgacgcccgagctggtggccgccgaactgccggagatcatc
cgcgcgatcgaaatgaacggtccggtccaggtcggagcggccattccgatgtatctggcc
acgaaggccgccgcccgggatggtcatcgcgtgctttattccggacaggcggctgacgaa
ttgttcgctggctacgactggtatcgggaggtgctacagcgcgaaggcccactgaccctg
catgcccggctctgggaggacatcgatgcgctatatgtcgacacgctcgagcgcgaggat
cgtacctcgatggcgcacagtgtcgagctgcgcgcccccttcctggatcgcgacctgctg
cgggtggccatgcggatggatccgcggctgaagttgccggacgccggggccgaaggaaag
tggatacaccggcggctggcggcgcgtcgcggtgtgccggaatggattgcctttggcgcc
aaggtgcgggcccaggacggggcctctgtgggcgatgtgctggaggaggtcgcccggcaa
aacctgcgcagtgcgttgcccggcaagcgggaaatgttgtgcgactatgggagtaactat
cgctacggcgtcgatccggacagcagtccggccattgccagcctgctctatcaggtgacg
cggacgcatcgcattgcgattccccgcgtgcaggatgcgtggcccggttcggtgtcgctt
acgcgcgatcggaaagccagggttgtcgccctgaccggtaactga

DBGET integrated database retrieval system