KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_2385Help
Entry
Rhom172_2385      CDS       T01606                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
rmg00250  Alanine, aspartate and glutamate metabolism
rmg01100  Metabolic pathways
rmg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rhom172_2385
Enzymes [BR:rmg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Rhom172_2385
Peptidases [BR:rmg01002]
 Cysteine Peptidases
  Family C44
   Rhom172_2385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 tRNA_Me_trans QueC ThiI NAD_synthase CheB_methylest TT_ORF2a
Motif
Other DBs
NCBI-ProteinID: AEN74278
UniProt: G2SKY5
Position
complement(2715394..2717058)
Genome map
AA seq 554 aa AA seqDB search
MCSIVGCVASESSSVEETLFLLRHTRHRGPDAVGLYADGEVIQDVRLEGLAARVQGQKAR
ISLGHCRLEIVGGPAARQPMASCDGRLRLIHNGEIYNYQELRALLKGHRLQTRSDSEVLV
HLIETYYRGDLAEAVQAVLPLLDGMYAFAVTDGQAVVVARDPFGKKPVYFTPTWPVRFAS
EAKALVAHTSSVLRLPPGHLLVIQENEVQVRQGVTLERPPINIQEESEALEAYADAFDQA
IAKRTIGQRRVAVLLSGGVDSTLLAKALVDRGLEVTGYCVGQPEASDVQLVKRLARTLGL
SVHVTELTPELVAAELPEIIRAIEMNGPVQVGAAIPMYLATKAAARDGHRVLYSGQAADE
LFAGYDWYREVLQREGPLTLHARLWEDIDALYVDTLEREDRTSMAHSVELRAPFLDRDLL
RVAMRMDPRLKLPDAGAEGKWIHRRLAARRGVPEWIAFGAKVRAQDGASVGDVLEEVARQ
NLRSALPGKREMLCDYGSNYRYGVDPDSSPAIASLLYQVTRTHRIAIPRVQDAWPGSVSL
TRDRKARVVALTGN
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcgattgttggctgtgtagcctcggagtcgtcctctgttgaagaaaccctgttc
ttgctgcgacacacgcgtcatcgtggtccggatgcagtgggcctgtatgccgatggcgag
gtgattcaggacgtgcggttggaaggcctggccgcgcgtgtgcagggacagaaagcccgc
atcagtctgggacattgtcgactggaaattgtcggggggccggctgcgcgccagccgatg
gccagttgcgacgggcggttgcggctcatccataatggggaaatctataattatcaggag
ctgcgtgcgctgttgaagggacatcgtctgcagacccggagtgacagcgaggtgctggtc
cacttgatcgaaacctattacaggggagatctggccgaggcggtgcaggctgtgctgcca
ctgctcgatggcatgtatgcctttgcggtaacggacgggcaggcggtcgtagtggcccgt
gatcctttcgggaagaagccggtctatttcacgcctacctggccggtgcgttttgcttcg
gaagccaaggcactggtcgcgcacacgtcgtccgttctgcggttgccgcccgggcatttg
ctggttatccaggagaacgaagtgcaggtgcggcagggggtaacgctggagcgcccgccc
atcaacattcaagaggagagcgaggccctggaggcctatgccgacgcattcgatcaggcg
atcgccaaacgtacgatcggacagcggcgggtggccgtattgctttccggcggagtggac
agcacgttgctggccaaggcgctggtggatcggggcctggaggtgaccggctactgcgtg
gggcagcccgaggcctcggatgtgcaactggtgaaacggctggcgcgcacgctggggcta
tcggtgcacgtgacggaactgacgcccgagctggtggccgccgaactgccggagatcatc
cgcgcgatcgaaatgaacggtccggtccaggtcggagcggccattccgatgtatctggcc
acgaaggccgccgcccgggatggtcatcgcgtgctttattccggacaggcggctgacgaa
ttgttcgctggctacgactggtatcgggaggtgctacagcgcgaaggcccactgaccctg
catgcccggctctgggaggacatcgatgcgctatatgtcgacacgctcgagcgcgaggat
cgtacctcgatggcgcacagtgtcgagctgcgcgcccccttcctggatcgcgacctgctg
cgggtggccatgcggatggatccgcggctgaagttgccggacgccggggccgaaggaaag
tggatacaccggcggctggcggcgcgtcgcggtgtgccggaatggattgcctttggcgcc
aaggtgcgggcccaggacggggcctctgtgggcgatgtgctggaggaggtcgcccggcaa
aacctgcgcagtgcgttgcccggcaagcgggaaatgttgtgcgactatgggagtaactat
cgctacggcgtcgatccggacagcagtccggccattgccagcctgctctatcaggtgacg
cggacgcatcgcattgcgattccccgcgtgcaggatgcgtggcccggttcggtgtcgctt
acgcgcgatcggaaagccagggttgtcgccctgaccggtaactga

DBGET integrated database retrieval system