KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_2410Help
Entry
Rhom172_2410      CDS       T01606                                 

Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rhom172_2410
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rhom172_2410
  Amino acid metabolism
   00310 Lysine degradation
    Rhom172_2410
Enzymes [BR:rmg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Rhom172_2410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2752668..2754401)
Genome map
AA seq 577 aa AA seqDB search
MARVEVVMPKMGESITEGTVVAWLKQPGDRVEADEPLLEIGTDKVDTEVPSPASGVLKEI
LVPEGETVAVGAVLAVIETEAEAAAEAKPAAPAPEAAPAPEAPKTEAAAPEPEPKPEAAP
EAGGEIVEVVMPKMGESITEGTVVAWLKQPGDRVEADEPLLEIGTDKVDTEVPSPASGVL
KEILVPEGETVAVGTVLARIATGAPAAAVPQQPATQPTAAPEPKPEPAPTPAPQPAPAGD
GAPAAGPIPRRGPDGRFYSPLVRSIAEKEGLTPEELAAIPGSGRGGRVTKQDVLQYLEQR
RQRVQQPAARPAEPRPAAPPKPERPAAPRPAPQVVTGTQEGRVEIIEMDRMRQLIAEHMI
RSKRTSAHVTSFAEVDVTNLVRVRERNKERFEQREGVRLTYLPFFVQAVVEALKEHPLLN
ASVEGTRIIVKKDYHIGIAVALGTTGLVVPVIRDAGQKNLVGLAHAIADLVQRARNKQLQ
PDELQGGTFTITNVGSLGSLMGTPIINQPQVAILATGAIKKRPVVIEHPELGDVIAIRHM
MYLSLSYDHRIIDGAMAASFLRKVTEGLESIDPNLEL
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcgtcgaagtggtgatgcccaagatgggcgagagcattacggaggggacggtg
gtggcgtggttgaagcagccgggggatcgggtggaggcggacgagccgttgctggagatt
ggcacggacaaggtggacacggaggtgccgtcgccggcttcgggggtgctcaaggagatt
ctggtgccggagggcgagacggtggccgtcggcgccgtcctggccgtcatcgaaacggag
gcggaagcggccgccgaagcgaagccggctgcgcccgcgccggaagccgccccggctccc
gaagcgccgaagacggaagccgctgcgccggagcctgaaccgaagcccgaggccgcaccg
gaggcgggcggcgagatcgtcgaagtggtcatgcccaagatgggcgagagcattacggag
gggacggtggtggcgtggttgaagcagccgggagatcgagtggaggcggacgagccgttg
ctggagatcggtacggacaaggtagacacggaggtgccgtcgccggcttcgggggtgctc
aaggagattctggtgccggagggcgagacggtggccgtcggcaccgtcctggcccgcatt
gcgacgggcgctccggccgccgccgtgccgcagcagccggctacgcagccgaccgctgca
ccggaaccgaagcccgaacccgcaccgacccctgcgccgcaaccggcgcctgcaggcgac
ggcgctccggccgccggaccgatcccgcgccggggaccggacggccgcttctactcgccg
ctggtgcgctccattgcggaaaaggaagggctgacgcccgaagagctggccgccatcccg
ggcagcgggcgcggtggccgcgtcacgaaacaggacgtgctccagtacctggagcagcgg
cggcagcgcgtgcagcaaccggccgcgcgtcctgccgagccccgtccggcggcgcctccg
aaaccggagcgtcccgcagcgccgcgtccggccccgcaggtagtgacgggcacccaggaa
ggccgcgtcgagatcatcgagatggatcggatgcggcagctcatcgccgagcacatgatc
cgctcgaaacgcacctcggcccacgtgacttcgtttgccgaggtggacgtgacgaacctg
gtgcgcgtgcgggagcgcaacaaggaacgcttcgagcagcgcgagggcgtccggttgacc
tatcttcccttcttcgtgcaggccgtcgtcgaggcgctgaaggagcatccgctgttgaac
gcttcggtcgagggcacgcggattatcgtcaaaaaagattaccacatcggcattgccgtc
gcgctgggcacgacgggcctggtggtgccggtcattcgagatgccggacagaagaacctg
gtcggtctggcccacgccatcgccgatctggtgcagcgtgcccgcaacaagcagctgcag
cccgacgaattgcagggtggcaccttcacgatcacgaacgtgggctcgctgggctccctg
atgggcacgcccatcatcaatcagccccaggtggccatcctggcgacaggggccatcaag
aagcggccggtggtgatcgagcaccccgaactcggcgacgtgatcgccatccgccacatg
atgtatctgtcgctttcctacgaccatcggatcattgacggggccatggcggcctccttc
ctgcgcaaggtgacggaagggctcgagtcgatcgatccgaacttggagctgtag

DBGET integrated database retrieval system