KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_2600Help
Entry
Rhom172_2600      CDS       T01606                                 

Definition
(GenBank) Pyruvate synthase (EC:1.2.7.1)
  KO
K00169  
pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rhom172_2600
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rhom172_2600
   00020 Citrate cycle (TCA cycle)
    Rhom172_2600
   00620 Pyruvate metabolism
    Rhom172_2600
   00640 Propanoate metabolism
    Rhom172_2600
   00650 Butanoate metabolism
    Rhom172_2600
  Energy metabolism
   00680 Methane metabolism
    Rhom172_2600
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Rhom172_2600
Enzymes [BR:rmg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Rhom172_2600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2975367..2976566
Genome map
AA seq 399 aa AA seqDB search
MTLVVIPRLEAAQLLTGAQAVAHAMRQIEPDVVPVYPITPQTPIIEEFAQMVADGRCDTE
IINVESEHSAMSAAVGASVAGARVMTATASQGLALMIEVLYIAASMRCPIVMPLGNRALS
GPINIHCDHSDAMLARDSGAVQIFTENGQEAYDYTLMAVRLAEDQRVLLPVIVNLDGFTL
THSAEAVELLPDEVARAFVGHYRPLYPLLDTARPTTQGPFDMPDFYYEHKRQQDEAMRGV
LEVFPEVQRAYAEATGRNYRGYYEAYRLDDADFAVVVLGSTAGTAKVVVDTLRDEGQRVG
LLKLWLFRPFPHAAVAEALRGKQAVAVMDRALSFGSWGPLFTEIAAALYSLPEAERPRLY
NFTYGLGGRDVTPDQIAEALTRIQDPRTPAVMHYLGVRA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgtggtcattccccggctcgaagccgcccagctactgacgggcgcgcaggct
gtggcgcatgccatgcgccagatcgagcccgacgtcgtgccggtctatccgatcacgccg
cagacgccgatcatcgaggagtttgcgcaaatggtggccgacggccgctgcgacaccgag
atcatcaacgtcgagtcggagcactcggccatgagcgcggccgtgggcgcctcggtggcc
ggcgcacgcgtgatgacggccacggcctcgcagggcctggcgctgatgatcgaggtgctc
tacatcgcagcctccatgcgctgcccgatcgtaatgccgctgggcaaccgggcgctgagc
gggccgatcaacatccactgcgatcattccgacgccatgctggcccgcgattcgggtgcc
gtccagatcttcaccgaaaacggccaggaagcctacgactacacgctgatggccgtgcgc
ctggccgaagaccagcgggtgctgctgcccgtgatcgtcaacctggacggcttcacgctc
acgcattcggccgaggccgtcgagctgctgcccgacgaggtggcccgggcgttcgtgggc
cattaccggccgctctatccgctgctggacacggcgcgccccaccacgcagggcccgttc
gacatgcccgacttctactacgagcacaagcggcaacaggacgaggccatgcggggcgtg
ctggaggtcttccccgaggtgcagcgcgcctacgccgaggccaccggacgcaactaccgg
ggctactacgaagcctaccggctcgacgacgcggactttgccgtggtcgtgctgggatcg
acggccggaacggcaaaggtcgttgtcgacacgcttcgggacgaagggcaacgggtgggt
ctgctcaagctgtggctcttccgccccttcccgcatgccgccgtggccgaagcgctccgc
ggtaagcaggccgtggccgtgatggaccgggcgctgtcgttcggaagctgggggccgctc
ttcaccgaaatcgccgcggccctgtacagcctgcccgaagccgagcggccgcgcctgtac
aacttcacctacggcctgggtggacgcgacgtcacgcccgaccagattgccgaagcgctg
acccgcattcaggatccgcgtacgcctgctgtcatgcactacctgggcgtacgcgcctaa

DBGET integrated database retrieval system