KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_2601Help
Entry
Rhom172_2601      CDS       T01606                                 

Definition
(GenBank) Pyruvate synthase (EC:1.2.7.1)
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rhom172_2601
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rhom172_2601
   00020 Citrate cycle (TCA cycle)
    Rhom172_2601
   00620 Pyruvate metabolism
    Rhom172_2601
   00640 Propanoate metabolism
    Rhom172_2601
   00650 Butanoate metabolism
    Rhom172_2601
  Energy metabolism
   00680 Methane metabolism
    Rhom172_2601
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Rhom172_2601
Enzymes [BR:rmg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Rhom172_2601
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2976583..2977590
Genome map
AA seq 335 aa AA seqDB search
MMTGLSSNGEAIRLKTLKELAEREQRELRFQGGHSLCAGCGVPLVVRTVLNAIDTPVVVV
NATGCLEVATTRYPSTAWNVPWLHVAFENAAAAASGVEAAFRVLNRKCKNGRPIPFDLPE
DVRIIAFGGDGGTYDIGLQALSGALERGHRFTYICYDNEAYMNTGNQRSGATPPLAHTTT
TPVGEQSLGKLQQRKDLTEIAVAHHVPYVAQASISNWQDLVRKIQMAVQVDGPSFLNVLA
PCQRGWGYDPSQTVEIARLAVETCFWPLYEVIDGEYRLNYRPRKPLPIAEWVKTQGRFRH
LLRPEHRHLLDALQEQVNREWERLLRKCEGRLLEV
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccgggctttcctccaacggcgaagcgattcgcctgaagacgctcaaggaactg
gccgaacgcgagcagcgcgagctgcgcttccagggcggccactcgctctgtgcgggctgc
ggcgtgccgctggtggtgcgcaccgtgctgaacgccatcgacacgcccgtggtggtggtc
aacgcgacgggctgcctggaggtggccaccacgcgctatccttcgacggcctggaacgta
ccctggctgcacgtggccttcgagaacgcggccgccgccgccagcggcgtggaggccgcc
ttccgggtactcaaccgcaagtgcaaaaacggccggccaatccccttcgacctgcccgaa
gacgtgcgcatcatcgccttcggcggcgacgggggcacctacgacatcgggctgcaggcc
ctctcgggcgccctggagcgcgggcaccgcttcacctacatctgctacgacaacgaagcc
tacatgaacacgggcaaccagcggagtggcgccacgccgccgctggcccatacgaccacc
acgcccgtgggcgaacagagcctgggcaaactccagcagcgcaaggacctgacggagatc
gccgtcgcccaccacgtgccgtatgtggcccaggcgtcgatctcgaactggcaggatctg
gtgcgcaagatccagatggccgtgcaggtggacggaccgagctttctcaacgtactggcg
ccctgccagcgcggctggggctacgatccgtcccagaccgtcgagattgcccgcctggcc
gtcgaaacgtgcttctggccgctctacgaggtgatcgacggcgagtaccggctgaactac
cgaccgcgcaagccgctgcccatcgccgagtgggtcaaaacgcagggacgcttccgccac
ctgctccgcccggagcaccgacacctgctcgacgcgctacaggagcaggtcaaccgcgaa
tgggagcggctgctgcgcaaatgcgaaggacgcctgctggaagtgtag

DBGET integrated database retrieval system