KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_2613Help
Entry
Rhom172_2613      CDS       T01606                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Rhom172_2613
  Lipid metabolism
   00561 Glycerolipid metabolism
    Rhom172_2613
   00600 Sphingolipid metabolism
    Rhom172_2613
Enzymes [BR:rmg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Rhom172_2613
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2988040..2989251
Genome map
AA seq 403 aa AA seqDB search
MRRLLLSLAGLLVTGVVFGQKFEQLARTPPMGWNSWNHFGCNINEQIVREVAEAMVRSGM
RDAGYEYVIIDDCWQGERDSLGFIQPDPERFPSGMKALADYIHSLGLKFGIYSDAGDRTC
AGRPGSRGHEYQDALTYARWGVDYLKYDWCHTENLNPIGAYTTMRDALYAAGRPIVFSIC
EWGTNEPWKWGRTIGHLWRTTGDITNCWDCVIDHGTWKSWGILQILDRQDGLRIYAGPGH
WNDPDMLEVGNGMRVSEDRAHFSMWAMLAAPLIAGNDVRHMSETTRAILTNREVIAVDQD
TLGIQGFPYRREAGVEIWFRPLAGGDWAMAILNRTETPRTVTFNFRETYIFDDFSRRGTF
FDRITYRLRDLWAHRDIGTTETPLTVEVPGHDVVMLRLIAPKP
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgactgctgctgagtctggcgggcctgctggtgaccggcgtggttttcggtcag
aaattcgagcaactggcccgaacgcccccgatgggctggaacagctggaatcacttcggc
tgcaacatcaacgagcagatcgtgcgcgaggtggccgaggccatggtacgctcgggcatg
cgcgatgccggctacgaatacgtgatcatcgacgactgctggcagggcgagcgcgacagc
ctgggcttcatccagcccgaccccgagcgttttccatcgggcatgaaggcactggccgac
tacatccacagtctgggcctgaagttcggcatctactcggacgctggcgaccgcacctgt
gccggacggcccggcagccgcggccacgagtaccaggatgccctgacctacgcccgctgg
ggtgtcgattatctgaagtacgactggtgccatacggagaacctgaaccctatcggcgcc
tacaccacgatgcgcgatgcgctctatgcggccgggcgccctattgtcttcagcatctgt
gaatggggcacgaacgagccctggaagtggggccgtacgatcggccacctgtggcgcacc
accggcgacatcaccaactgctgggactgcgtcatcgaccacggtacctggaagtcgtgg
ggcattctacagattctggacaggcaggacggcctgcgcatctacgccggtcccggccac
tggaacgaccccgacatgctggaggtgggcaacggcatgcgcgtcagcgaagaccgcgcc
cacttctcgatgtgggccatgctggccgcgccgctcatcgccggcaacgacgtccgccac
atgtcggagaccacgcgcgcaatcctgaccaaccgggaggtgatcgccgtcgatcaggac
acgctgggcatccagggctttccctatcggcgggaggccggcgtggagatctggttccgg
ccactggcgggcggcgactgggccatggccatcctgaaccgcaccgaaacgccccgcacc
gtgacgttcaacttccgggagacatacatctttgacgacttttcccggcggggtaccttt
ttcgaccggatcacctaccggctgcgcgatctgtgggcgcatcgggacatcggcaccacc
gagacgccgctcaccgtcgaggtccccggccacgacgtggtcatgctccgattgattgcg
ccgaagccgtaa

DBGET integrated database retrieval system