KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_2624Help
Entry
Rhom172_2624      CDS       T01606                                 

Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Rhom172_2624
DNA repair and recombination proteins [BR:rmg03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Rhom172_2624
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3001684..3002331
Genome map
AA seq 215 aa AA seqDB search
MSFTSPSVEALVEQLMRLPTVGRKTAQRLAAYILKMPREEVEALAQALLAVKERVRQCAI
CFNVTDEEVCAICRSPRRDHATICVVEEPSDVLALERTGEYRGVYHVLGGVISPLDGIGP
DDLRIRELVARVAPTNGDPERAALYPEGRIPRVQEVILALNPNVEGDTTAYYLAQLLKPL
GVRVTRIARGLPIGGDLEYADEATLSRALEGRLAL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgagtttcacttcgccttcggtcgaagcccttgtcgagcagctcatgcggctgcccacc
gtcgggcgcaaaacggcccagcggctggcggcctatatcctgaaaatgccccgcgaggaa
gtggaggcgctggcgcaggctctgctggccgtcaaagaacgcgtgcgccagtgtgccatc
tgcttcaacgtgaccgacgaagaagtctgcgccatctgccgctcgccccggcgggaccac
gccaccatctgcgtggtcgaagaacccagcgacgtgctggccctggagcgcacgggcgag
taccggggcgtctaccacgtgctgggcggcgtcatctcgccgctggacggtatcggcccg
gacgacctgcgcatccgtgaactcgtggcccgcgtggcgcccaccaacggcgaccccgag
cgggccgcgctctatccggaaggtcgtattccgcgtgttcaggaagtcatcctggcgctg
aatcccaacgtcgaaggcgacacaactgcctactatctggcgcagctgctcaaacccttg
ggcgtgcgcgtcacccgcattgcccgcggcctgcccatcggaggtgatctggagtacgcc
gacgaggccacgctctcccgtgcgctggaggggcgcctggccctttaa

DBGET integrated database retrieval system