KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_2717Help
Entry
Rhom172_2717      CDS       T01606                                 

Definition
cell cycle protein
Orthology
K03588  
cell division protein FtsW
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3100714..3101892)
Genome map
AA seq 392 aa AA seqDB search
MNRLRATSRSKKTTKSKPSADRYVQLVVVALMAFGVVAVYSAVSFLAETKAGGEPERLLL
RHLVRVLLAASAIVVVSRMDYRRLARWSKPLLLGSLGLLLLVQVAGVAFGGATRWLRIGS
LAFQPSDLAGVALLLHLSVLLTRKQSYIHAFDRGFLPLLFWILLTAVLIGIENLSTAALL
TASMLLLCFVGRVRVLHLAGSGLLGLLLATLMLLTSPQRAARVEAFLGTKIFPHTEAEAV
FDPQNEGYQARQARIAFAMGGLTGVGPGKSVQRDFLPAPYNDFIFAIVAEEYGLIGALLL
LGALLVLLFRGYLRIARHAPDPLGFFLAFGATTMLVLQGFVHAAVTCGLLPVTGLPFPFV
SYGGTSLMTSGILVGLLLSVSRRVQSPETERS
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgactgcgtgcgacatcccgatcgaagaagaccacaaagtcgaagccttcggcc
gaccgctacgtgcagctcgtggtggtggcgctgatggctttcggcgtggtggccgtctac
agcgccgtgtcgtttctggccgagacgaaggccggaggcgaaccggaacgcctgctgctg
cgccacctggtgcgtgtgctgctggcggccagcgccatcgtcgtggtgtcgcgcatggac
taccggcggctggcccgctggagcaagccgctgctgctgggatcgctggggctgctgctg
ctggtgcaggtagctggcgtggccttcggcggggcgacgcgctggctacgcatcggctcg
ctggccttccagccatcggatctggccggtgtggcgctgctgttgcacctttcggtgctg
ctcacgcgcaagcaaagctatatccatgcgttcgatcggggtttcctcccgttgctgttc
tggatcctgctgacggccgtactgatcggcatcgaaaatctttcgacggccgcgctgctg
acggccagcatgttgttgctgtgcttcgtggggcgggtgcgggtgctgcacctggccggc
tcggggctgctcgggctgctgctggctacgttgatgctgctgacctcgccgcagcgggcg
gcccgtgtggaggccttcctgggcaccaaaatcttcccgcacacggaggccgaggcggtt
ttcgatccacagaatgaaggctatcaggcgcgccaggcccggattgccttcgccatgggc
gggctgacgggcgtcgggcccggcaagagcgtccagcgcgattttctgccggcgccctac
aacgacttcatctttgccatcgtggccgaggaatacggcctgatcggggcgctgctgctc
ctgggagcgctgctggtgctgctgtttcgcgggtacctgcgtattgcccggcatgcgccc
gaccctttaggctttttcctggccttcggcgccacgaccatgctggtgctgcagggcttt
gtgcatgcagcggttacctgcgggctgctgccggtgacgggcctgccgttcccgttcgtg
tcgtacggcggtacttcgctgatgaccagtggcatcctggtgggcctgctgctgagtgtt
tctcgacgggttcaatcacctgaaacggagcggtcctga

DBGET integrated database retrieval system