KEGG   Rhodothermus marinus SG0.5JP17-172: Rhom172_2811Help
Entry
Rhom172_2811      CDS       T01606                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
rmg  Rhodothermus marinus SG0.5JP17-172
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rmg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rhom172_2811
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Rhom172_2811
Enzymes [BR:rmg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Rhom172_2811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3214530..3217106
Genome map
AA seq 858 aa AA seqDB search
MRTVRILLLTGLLPALTLARHPERLTVYWGVVANQDNGRARWELTLVNQDTVALPASGWT
LYFNFMRPILPESAPPSVRLTHVNGDFYRLDPTDTFAPLPPGARRTLSFESMGPLIKAID
APSGLYLVFQEAPNRPVPIQDVRVLPFASEFQTRRHPADRLPVPTPALRYYRNASLRLLP
VDSLTPVVPTPRQLTRRQGHWTLDRTATIAYEPTLAREAAFLADALAPLLGARPRLLEGA
DRPATIRLRLGAVRLSDGPAGPEAYHLVVDPEAGITLTGTDAAGVFYGIQTLQQLIDPAF
YRRPSAAIPIPALEVYDAPRFGYRGLHLDVARNFQPKAVVLRLLDLMARYKLNRFHFHLT
DDEGWRLEIDGLPELTEVGGCRGHTETEATCLVPSHGSGPIPGQLPGSGYYTREDFVEIL
RYATARHIEVIPEIDVPGHARAAIKAMEARYARLKVAGRPEAEAAAYRLVDPADTSSYRS
VQGWNDNVINVCLPSTYRFLEKVVDELRRLYDEAGAPLRVVHTGGDEVPHGAWAGSPACR
AVMQTEGTADPAALQQYFLDRFDQILRQRGLRTAGWEEIGLIAAEENGRRVHRPNPRFRD
RGFLVYAWNNIWGSGAEDHAYRLANAGYDVVLSLASNLYFDLAYTKHPDEAGLYWAGFVD
NDAPYRLEPFDLFLGPIQHWLGHTLPPEAFAHHERLTAEGRPRIVGLQGQLWGETLRTPD
RVFYMAVPRMLALAERAWAERPAWSRIADPEARQRALQAAWNAFANRLGRRELPRLDALY
GETVPYRLPPPGAVVEDGYLKANVALPGLTIRYTLDGSTPTAASPRYTEPVRLEGHGEVH
LRTFDTNGRGSRTVRVVY
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaccgttcggattctgctgctgaccggcctgctgcctgccctgacgctggcccgg
caccccgagcgcctgaccgtttactggggcgtggttgccaaccaggacaacggccgggcc
cgctgggaactgaccctggtcaaccaggacaccgtggcgctgcccgcctcgggctggaca
ctctatttcaacttcatgcgtccgatcctgcctgaaagcgccccgccttcggtgcggctc
acgcacgtcaacggcgacttctaccgcctggaccccaccgacacgttcgcgccgctgccg
ccgggcgcacgccgcacgctgtcgttcgaatcgatgggtcccctcatcaaggccatcgac
gctccctcggggctctacctcgtcttccaagaggcgccgaaccgtccggtcccgatccag
gatgtgcgcgtgctgcccttcgcctcggagtttcagacgcggcgacatccggccgatcgg
ctgcccgtacccacgccggccctgcgctactaccggaacgcctcgctccgactgctgccg
gtcgatagcctgacaccagtcgttcccaccccgcgccagctcacgcgtcggcaagggcac
tggacgctcgaccgcacggccaccatcgcttacgaaccgacgctggcccgcgaggcggcc
ttcctggccgacgccctggcgccgctgctgggcgcacggccccgcctgctggaaggcgcc
gaccggcccgccacgatccgcctgcgcctcggcgcggttcgcctgtccgatgggccggcc
ggtccggaagcctaccatctggtcgtggatccggaggcgggcatcacgctcaccggcacc
gacgccgccggggtcttctacggcatccagacgctgcaacagctcatcgacccggctttc
taccgtcggccttcggcggccatcccgatcccggccctcgaagtgtacgacgcgccgcgc
ttcggctaccgggggctgcacctcgacgtggcccgcaatttccagccgaaggcggtggtg
ctccggttgctcgacctgatggcgcgctacaagctcaaccggttccactttcacctgacc
gacgacgagggctggcgcctggagatcgacggcctgcccgaactgaccgaggtgggcggc
tgccgcggccacaccgaaacggaagcaacctgtctggtgccctcgcacggctccggaccg
atccccggccaactgcccggaagcggctactacacgcgcgaggactttgtcgaaatcctg
cgctacgccacggcccggcacatcgaggtgatccccgaaatcgacgtgcccggccacgcc
cgcgcggccatcaaagccatggaagcccgctatgcccgcctgaaggtggccggccgccct
gaagccgaagcggccgcctaccggctcgtcgatccggccgacacgtcctcttaccgctcc
gtgcagggctggaacgacaacgtgatcaacgtctgtctgccctcgacctatcgctttctg
gaaaaggtggtggacgaactccggcggctctacgacgaagccggggcgccgctccgcgtg
gtgcacaccggcggcgacgaggtgccgcacggcgcctgggccggctcgcccgcctgccgg
gccgtcatgcagaccgagggcaccgccgatccggccgcgctgcagcagtacttcctggat
cggttcgatcagatcctgcgacaacgcggactgcgcacggcgggctgggaagagatcgga
ctgatcgctgccgaggaaaacggacggcgcgtgcatcgtcccaacccgcgcttccgcgat
cggggcttcctggtctacgcctggaacaacatttggggcagcggggccgaggatcacgcc
taccggctcgccaatgcgggctacgacgtggtgctctcgctggcctcgaacctgtacttc
gatctggcctacacaaagcatcccgacgaggccggactctactgggcgggcttcgtggac
aacgacgcgccgtaccgcctggagccgttcgatctgtttctggggccgatccagcactgg
ctgggccacacgctcccgcccgaagcgttcgcccaccacgagcgcctgacggccgaagga
cggcctcgcatcgtggggctacaggggcagctctggggcgagacgctccgcacgccggac
cgcgtcttctacatggccgtgccccggatgctggcgctggccgaacgcgcctgggccgaa
cgtccggcctggagccggatcgccgatccggaagcacggcaacgcgccctgcaggcggcc
tggaacgcgtttgccaaccggctgggccggcgcgaactgccccggctcgacgcgctctac
ggcgagaccgtgccttaccggctgccgcctcccggcgccgtcgtcgaggacggctacctg
aaggccaacgtggccctgccgggcctgacgatccgctacacgctggacggaagcacgccc
acggccgcctcgccccggtacacggagccggtccggctcgaagggcatggcgaagtgcac
ctgcgcacgttcgacacgaacggacgcggtagccgcaccgtgcgcgtggtttactga

DBGET integrated database retrieval system