KEGG   Rickettsia massiliae AZT80: RMB_00980Help
Entry
RMB_00980         CDS       T01758                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rmi  Rickettsia massiliae AZT80
Pathway
rmi00020  Citrate cycle (TCA cycle)
rmi00190  Oxidative phosphorylation
rmi00650  Butanoate metabolism
rmi01100  Metabolic pathways
rmi01110  Biosynthesis of secondary metabolites
rmi01120  Microbial metabolism in diverse environments
rmi01130  Biosynthesis of antibiotics
rmi01200  Carbon metabolism
Module
rmi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rmi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rmi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rmi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RMB_00980
   00650 Butanoate metabolism
    RMB_00980
  Energy metabolism
   00190 Oxidative phosphorylation
    RMB_00980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS tRNA_anti_2 PAP2 Cation_ATPase_C Fumarate_red_D
Motif
Other DBs
NCBI-ProteinID: AFB31119
UniProt: H6QKW4
Position
170921..171298
Genome map
AA seq 125 aa AA seqDB search
MVYDFKAAIVKAKNSGSAKSGSHHWLLQRVTGIILALCSVWLIYFTLTNKNNDINIIMWE
LKKPFNVVALLITVVISLYHAMLGMRVVIEDYISCHKLRNTLIIIVQLFCIVTIVAFVVA
IFYKG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgattttaaagcagcaattgtaaaagcaaaaaatagcggttctgctaaaagc
ggttctcatcattggttattgcaaagagtaacggggattatattagctttatgttctgtg
tggctaatatattttacgttaaccaacaaaaataatgatataaatattattatgtgggag
cttaaaaagccttttaatgtagtagctttgttaattacggtggttatttcgttgtatcat
gcgatgcttggtatgcgtgtagtaattgaggattatataagttgtcacaaattacgtaat
acattgattataatagtgcaattattttgcattgtgactattgtagcttttgtagtagcg
atattttataaaggataa

DBGET integrated database retrieval system