KEGG   Rickettsia massiliae AZT80: RMB_01305Help
Entry
RMB_01305         CDS       T01758                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rmi  Rickettsia massiliae AZT80
Pathway
rmi00020  Citrate cycle (TCA cycle)
rmi00310  Lysine degradation
rmi01100  Metabolic pathways
rmi01110  Biosynthesis of secondary metabolites
rmi01120  Microbial metabolism in diverse environments
rmi01130  Biosynthesis of antibiotics
rmi01200  Carbon metabolism
Module
rmi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rmi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rmi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RMB_01305
  Amino acid metabolism
   00310 Lysine degradation
    RMB_01305
Enzymes [BR:rmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RMB_01305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AFB31177
UniProt: H6QL22
Position
complement(236944..238146)
Genome map
AA seq 400 aa AA seqDB search
MSVKIIVPSLGESVTEATIAKWYKKEGDSVKTDELLLEIETEKVTLEVNAPCNGTIGKIS
KTDGANVAVGEEIGEINEGAAANTAGTHHNESAKAQAATQPTSEKPVEKPAVANNTLAPS
VQKLVTENKLDPNNIKGTGRDGRITKGDVLETINTTAISAPAISKSNEERVQRVRMSRLR
KTIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHAVKLGFMSFFVKATIEA
LKLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVVPIVRDADKMGFAEVEKAIGILAKK
AREGKLSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDGKIEIR
PMMYIAVSYDHRIIDGKEGVSFLVKIKQLIENPEKLLLDL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttaaaattatagtaccgtcacttggggagtccgtaacggaagcaactattgcc
aaatggtataagaaagaaggcgattcggttaaaaccgatgaattactgttagaaatcgaa
accgaaaaagtgactttagaagtgaatgctccttgcaacggtactataggtaaaatatca
aaaactgacggtgcaaatgtagcagttggcgaagaaataggcgaaataaatgaaggggca
gctgcaaatactgccggtactcatcataatgaatctgctaaagctcaagcagcgacgcaa
cctacttcagaaaagcctgtagaaaaacctgccgtggctaataatactcttgctccttct
gtacaaaaattagttaccgaaaataagcttgaccccaataatatcaaaggaacaggtaga
gacggtagaattaccaaaggtgacgtgcttgaaacaataaacactacggctatttctgct
cctgcaataagtaaatctaatgaagaaagagtgcagcgtgttcgtatgtcacgcttgcgt
aaaactattgcacagcgtttaaaagattcacaaaatacagcagctattttgactactttt
aatgaaatcgatatgtcaaaagtaattgctttgcgtaatcaatataaagaagagtttgag
aaaaagcacgctgtgaaacttgggtttatgtctttctttgttaaagcaacaattgaagct
ttaaagcttattccgtcggtaaatgctgaaatagacggcgatgatttagtatataaaaat
tactatgatataggtgtagctgtcggaacagagcaagggcttgttgtaccgattgttagg
gatgccgataaaatgggatttgccgaagtggagaaagctataggaattttggctaaaaaa
gctcgtgagggtaagctttctatggctgatttgtcaggtgggacattctcgatttctaac
ggaggcgtatatggctcattattatctacaccgattattaatcctcctcaatcaggtatt
ctaggcttacataaaaccgaggaaagagctgtagttatagacggtaaaattgaaatacgt
ccgatgatgtatatagctgtatcttacgatcatcgtataattgacgggaaagaaggagta
tcgttcttggtaaaaattaagcagcttattgagaatcctgaaaagttattgttagatttg
taa

DBGET integrated database retrieval system