KEGG   Rickettsia massiliae AZT80: RMB_04515Help
Entry
RMB_04515         CDS       T01758                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rmi  Rickettsia massiliae AZT80
Pathway
rmi00010  Glycolysis / Gluconeogenesis
rmi00020  Citrate cycle (TCA cycle)
rmi00620  Pyruvate metabolism
rmi01100  Metabolic pathways
rmi01110  Biosynthesis of secondary metabolites
rmi01120  Microbial metabolism in diverse environments
rmi01130  Biosynthesis of antibiotics
rmi01200  Carbon metabolism
Module
rmi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rmi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RMB_04515
   00020 Citrate cycle (TCA cycle)
    RMB_04515
   00620 Pyruvate metabolism
    RMB_04515
Enzymes [BR:rmi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     RMB_04515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 CAT QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AFB31686
UniProt: H6QJ36
Position
complement(779972..781210)
Genome map
AA seq 412 aa AA seqDB search
MPIKILMPALSPTMTEGNLARWLKKEGDKVNPGEVIAEIETDKATMEVEAVDEGILAKIV
IPQNSQNVPVNSLIAVLSEEGEEKTDIDAFIAKNNSVSPSPKTDANLLKPHENLANVEEQ
VTVIKHDASKIFASPLAKRLAKMGNIRFESVKGSGPHGRIVKQDILSYTPSTAHNKIVSR
NPEEYRLVPNNNIRKIIAKRLFESKQTVPHFYLSIECNVDKLLDIREDINKSFSEDKSTR
ISVNDFIILAVAKALQEVPNANASWGEDAIRYYNNVDISVAVAIENGLVTPIVKNANQKN
ILELSREMKELIKKAKDNKLTPEEFQGGGFTISNLGMYGIKNFNAIINPPQSCIMGVGAS
AKRAIVKNDQITIATIMDVTLSADHRVVDGAVGAEFLAAFKKFIESPALMLI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgccgattaaaattttaatgcctgccttatctccaactatgacggaaggcaatctagct
aggtggttaaaaaaagaaggggacaaagttaatcctggagaagtaattgctgaaattgaa
accgataaagcaacgatggaagtagaagcagtagacgaaggtatacttgccaaaatagtt
atcccacaaaatagtcaaaatgtacctgttaactctttaattgccgtgttaagtgaagag
ggagaagaaaaaacggacattgatgcgtttattgcaaaaaataatagtgtatcaccgtca
ccgaaaacagatgctaatcttctgaaaccccacgagaacctagctaatgtagaagaacag
gtaacagttataaaacatgatgctagtaaaatattcgcctcaccgcttgcaaaaagactt
gcaaaaatgggaaatattagatttgagagcgtgaaaggtagcggtccacacggtagaata
gtcaaacaggatatcttatcatatactcctagcactgctcataataaaatagttagcaga
aatcctgaagaatatcgtttagtaccaaataataatatccgcaagattatagccaagcgt
ctgtttgaatctaaacaaacagttccacatttttatttatctatagaatgtaatgtcgat
aaattgttagatatacgagaagacattaataaatctttttctgaagataaatcaacaagg
atatcggttaatgattttattattttagcagtagccaaagctttacaagaagtgccaaat
gccaatgctagctggggagaagatgcaattagatattataataatgtcgatatttcagta
gcggtagcgattgagaacggacttgttacgccgatagttaaaaatgccaatcaaaaaaac
attctagaactatctcgtgaaatgaaagaattaataaagaaagcaaaagataataaatta
acccctgaagaatttcagggcggagggtttaccatttctaacctcggtatgtacggtatt
aagaatttcaatgctataattaacccaccgcaaagttgtataatgggcgtcggagctagt
gcaaaacgtgctatagtcaagaatgatcaaatcactatagcaacaattatggacgtaact
ctttctgccgatcaccgagtagtagacggagcagtcggtgctgagttcttggcagcattt
aaaaagtttatagagagtcccgctttgatgttgatataa

DBGET integrated database retrieval system