KEGG   Rickettsia massiliae AZT80: RMB_05040Help
Entry
RMB_05040         CDS       T01758                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rmi  Rickettsia massiliae AZT80
Pathway
rmi00020  Citrate cycle (TCA cycle)
rmi00640  Propanoate metabolism
rmi01100  Metabolic pathways
rmi01110  Biosynthesis of secondary metabolites
rmi01120  Microbial metabolism in diverse environments
rmi01130  Biosynthesis of antibiotics
rmi01200  Carbon metabolism
Module
rmi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rmi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rmi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RMB_05040 (sucC)
   00640 Propanoate metabolism
    RMB_05040 (sucC)
   00660 C5-Branched dibasic acid metabolism
    RMB_05040 (sucC)
Enzymes [BR:rmi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     RMB_05040 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AFB31771
UniProt: H6QJC1
Position
868690..869850
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQAKEILRKYGVPTSTGLVVTKTEKINDTIDKLNTEVYVVKAQIHAGGRGKAGGV
KVVKSKEEAKKVAHDMFGINLVTHQTGPQGQKVNRLYIESGCDILKEYYFSIVFDRSASC
ITFIASTEGGVDIEEIAEKTPEKIIKFSVDPATGLQDFHMRGIAYELGFKDNQAKQMKEI
VKSVYNAFIETDATQIEINPLIVNSDGNLLALDAKITFDDNGLFQHPNITAMRDHDEEDP
LETRAANAGLSYVKMDGNIGCMVNGAGLAMATMDIIKLYGASPANFLDVGGGADRERIKE
ALKIILSDKEVQGILVNIFGGIMRCDIIAEGIIAAAKDIGIKVPLVVRLAGTNVEKGKEI
LSNSGLEIIPAHDLADAANKIVEAIR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatatcaagcaaaagagattttaagaaaatacggcgtacctacttcc
accgggctagttgttacgaaaaccgaaaagattaacgacaccatagataaattaaatacg
gaagtatatgtggttaaagcacaaatacatgccggcggtagaggtaaagcaggcggtgtt
aaggttgttaagagtaaggaagaagccaaaaaagttgctcatgacatgtttggtattaat
ttagtaacgcatcaaacaggacctcaaggacaaaaagtaaaccgtctttatatcgaatca
ggttgtgatattttaaaagaatattattttagtatagtatttgatagatcggctagctgt
attactttcatagcttctacagaaggaggagttgatattgaagaaatagcagaaaaaact
ccggaaaaaattattaaattttccgttgatcctgcaaccggtttacaagattttcatatg
cgaggcatagcttatgagttaggctttaaggataaccaagccaaacagatgaaagaaata
gtaaaatcagtctataatgcttttattgaaaccgatgcaacacaaattgaaatcaaccca
ttaattgtaaatagcgacgggaacttattagctttagatgcaaaaattacttttgacgat
aacggcttatttcagcatccgaatattacggcaatgcgtgaccatgatgaagaagatcct
ctagaaactagagcagcaaatgcaggacttagctatgtaaaaatggacggtaatatcggt
tgcatggttaacggtgccggtcttgccatggccactatggatattattaaactttacggt
gcttcacctgctaatttcttggatgtcggtggtggagctgatcgtgagcgtataaaagaa
gctttaaaaataattttatctgataaagaagtacaagggattctagttaatattttcggc
ggtatcatgcgttgtgatattatagcagaagggattattgcagctgcaaaagacataggt
ataaaagtaccgttagtagttcgtttagccggtacaaacgttgaaaaaggcaaagaaatt
ttatcaaattccggtttagaaataataccggcacatgatttagcagatgcggcaaataaa
atagttgaagcgatacggtag

DBGET integrated database retrieval system