KEGG   Rickettsia massiliae AZT80: RMB_06455Help
Entry
RMB_06455         CDS       T01758                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
rmi  Rickettsia massiliae AZT80
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rmi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    RMB_06455
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RMB_06455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1117502..1118029
Genome map
AA seq 175 aa AA seqDB search
MSGKELNKIVAAILFASLIAMMVGFVANILYKPTLELQHRGYSIAVQESSENQNTTALEQ
APVNIPELMKTANADNGREIAKKCLMCHSLDKDGPNKLGPHLWDVAGRPKASITNYKYSP
ALSKLGGVWDDDSLFVFLHKPSSYALGTKMSFAGISKPQDIADVILFLKTYVHDK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagaattaaataaaattgttgcagccatcttatttgctagtttaattgct
atgatggttggatttgttgcaaatatactatacaagcccactctagagttacaacatcgc
ggctacagcattgcggttcaagaatcatcagaaaatcaaaatactaccgcactagagcaa
gcaccggtaaatataccagaattaatgaagactgctaacgccgataacggtcgtgaaata
gccaagaaatgtttaatgtgtcattctcttgataaagacggtccaaataaactaggaccg
catctttgggatgtagcaggcagaccaaaagcaagcataacaaactataaatattcccct
gctctatcaaaacttggcggcgtatgggatgatgatagtttatttgttttcttacataaa
ccaagtagctatgcactaggaacaaaaatgtcctttgccggtatctcaaaaccacaagac
atagctgacgtaatattatttttaaaaacttatgttcatgataaataa

DBGET integrated database retrieval system