KEGG   Rickettsia massiliae AZT80: RMB_06455Help
Entry
RMB_06455         CDS       T01758                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
rmi  Rickettsia massiliae AZT80
Pathway
rmi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:rmi00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    RMB_06455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Senescence_reg
Motif
Other DBs
NCBI-ProteinID: AFB32012
UniProt: H6QK12
Position
1117502..1118029
Genome map
AA seq 175 aa AA seqDB search
MSGKELNKIVAAILFASLIAMMVGFVANILYKPTLELQHRGYSIAVQESSENQNTTALEQ
APVNIPELMKTANADNGREIAKKCLMCHSLDKDGPNKLGPHLWDVAGRPKASITNYKYSP
ALSKLGGVWDDDSLFVFLHKPSSYALGTKMSFAGISKPQDIADVILFLKTYVHDK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagaattaaataaaattgttgcagccatcttatttgctagtttaattgct
atgatggttggatttgttgcaaatatactatacaagcccactctagagttacaacatcgc
ggctacagcattgcggttcaagaatcatcagaaaatcaaaatactaccgcactagagcaa
gcaccggtaaatataccagaattaatgaagactgctaacgccgataacggtcgtgaaata
gccaagaaatgtttaatgtgtcattctcttgataaagacggtccaaataaactaggaccg
catctttgggatgtagcaggcagaccaaaagcaagcataacaaactataaatattcccct
gctctatcaaaacttggcggcgtatgggatgatgatagtttatttgttttcttacataaa
ccaagtagctatgcactaggaacaaaaatgtcctttgccggtatctcaaaaccacaagac
atagctgacgtaatattatttttaaaaacttatgttcatgataaataa

DBGET integrated database retrieval system