KEGG   Rickettsia massiliae AZT80: RMB_07180Help
Entry
RMB_07180         CDS       T01758                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
rmi  Rickettsia massiliae AZT80
Pathway
rmi00300  Lysine biosynthesis
rmi01100  Metabolic pathways
rmi01120  Microbial metabolism in diverse environments
rmi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rmi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    RMB_07180
Enzymes [BR:rmi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     RMB_07180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AFB32130
UniProt: H6QKD4
Position
1231203..1232348
Genome map
AA seq 381 aa AA seqDB search
MYINYLKDLIGFKSVTPKSDGAIEYIDDLLKQHGFKTEIKIFGDSKSEQVTNLYAVFGSN
EPNICFVGHVDVVLAGNHELWHNASPFKASQQDDKIYGRGAVDMKGAIACFLAASLDFIK
NNTDFKGSISFLLTSDEEGKAKHGTKEMLQYIYDQGYKINFAIVGEPTCEKEIGDAIKIG
RRGSVNFKLNIEGLSGHVAYPHKANNPLPCLIIILNELTNIKLDEGIEFFQRSNLEVTNI
EVSNNTSNVIPASTEASFNIRFNNLHSAETLAKQVEEIIKQHCKEYKVDYKLEYSSSAES
FIQNPSDKIKEFAKVVEHTLKIKPEFSTSGGTSDARFVKNYCPLVEFGLLSETAHKINEY
TKISDLQKLYDVYYNFLMEIL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtacattaactacttaaaagatttgattggttttaagtctgtaactcctaagagcgat
ggggctattgagtatattgatgatttgcttaaacagcacggctttaagaccgaaataaaa
atattcggtgattctaaaagcgagcaagtcactaatctttatgctgttttcggtagcaat
gagcctaatatttgctttgttggtcatgtagatgtagtgctggcaggcaatcatgagctt
tggcataatgcgagtccatttaaagctagccagcaagacgataagatatatggcagaggt
gcggtggatatgaaaggggctatagcgtgctttctagctgccagtttagattttataaaa
aataataccgattttaaaggttccattagtttcttacttactagtgatgaagagggaaaa
gcaaagcatggtactaaagaaatgctgcaatatatttatgatcaaggatataagataaat
tttgctattgtcggtgaacctacttgtgaaaaagaaataggcgatgcaattaagattggc
agaagaggaagtgttaactttaaattaaatatagaaggcttaagcgggcatgtagcttat
cctcataaagcaaataacccattgccttgcttaataataatattgaatgagttaacaaat
ataaaacttgatgaaggtattgaattttttcaacgttcaaatcttgaagtaacgaatatc
gaggtcagtaataatacttcaaacgtaattccggcaagtacggaagcatctttcaacata
cgttttaataatttacatagtgcagaaactttagcaaaacaggtagaagaaattattaaa
cagcattgtaaggaatataaagtagattataagttagaatatagtagttctgctgaaagt
tttattcagaaccctagcgataaaataaaagaatttgctaaagtagtagagcatacgctt
aaaataaagcctgaattctctacaagcggcggtacgtcggatgcaagattcgtcaaaaat
tattgtccgttagtagagtttggtttattatccgaaacggcacataaaataaacgaatac
acaaaaattagcgatttacaaaaattatatgatgtgtattataactttttgatggaaata
ctttaa

DBGET integrated database retrieval system