KEGG   Rickettsia massiliae AZT80: RMB_07185Help
Entry
RMB_07185         CDS       T01758                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
rmi  Rickettsia massiliae AZT80
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:rmi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RMB_07185
   00240 Pyrimidine metabolism
    RMB_07185
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    RMB_07185
   03430 Mismatch repair
    RMB_07185
   03440 Homologous recombination
    RMB_07185
Enzymes [BR:rmi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     RMB_07185
DNA replication proteins [BR:rmi03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     RMB_07185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1232507..1232971
Genome map
AA seq 154 aa AA seqDB search
MQQFSIYQTSDELLLKSILLLIEKCYYSDLKSVILTADADQQEMLNKNLWTYSRKQFIPH
GSKLDPQPEKQPIYITDKLQNPNNASVLVIISPTDIGKILQAKEYIRVFKRIIIITDLPE
DLKELTVKINKFTGQENKIDCFTQNPRGAWSKVV
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaatttagtatttatcaaacaagcgatgaattgcttctaaaatcgatattgctt
ctgatagaaaaatgctattactctgatcttaaaagcgtgatattaactgcagatgcagat
caacaagaaatgctcaataaaaatctttggacttattcacgtaagcaatttatacctcac
ggtagtaaacttgatccgcagcctgaaaaacagccgatttatattaccgataagttacaa
aatcctaataatgctagtgtgcttgtgattatttcgcctacagatataggaaaaatttta
caagcaaaagagtatataagagttttcaaaaggataattataataaccgatttaccggaa
gatttaaaagaattaacagttaaaataaataaatttaccggacaggaaaacaaaatagat
tgttttactcaaaatcctcgtggagcttggagtaaagtagtctaa

DBGET integrated database retrieval system