KEGG   Rickettsia montanensis: MCI_00105Help
Entry
MCI_00105         CDS       T01784                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
rmo  Rickettsia montanensis
Pathway
rmo00020  Citrate cycle (TCA cycle)
rmo00640  Propanoate metabolism
rmo01100  Metabolic pathways
rmo01110  Biosynthesis of secondary metabolites
rmo01120  Microbial metabolism in diverse environments
rmo01130  Biosynthesis of antibiotics
rmo01200  Carbon metabolism
Module
rmo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rmo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rmo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MCI_00105 (sucC)
   00640 Propanoate metabolism
    MCI_00105 (sucC)
   00660 C5-Branched dibasic acid metabolism
    MCI_00105 (sucC)
Enzymes [BR:rmo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MCI_00105 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AFC72999
UniProt: H8KA22
Position
complement(19793..20956)
Genome map
AA seq 387 aa AA seqDB search
MNIHEYQAKEILRKYGVPTSTGLVVTKTEKINETIDNLNTEVYVVKAQIHAGGRGKAGGV
KVVKSKEEAKKVAHDMFGINLVTRQTGPQGQKVNRLYIESGCDILKEHYFSIIFDRSTSR
ITFIASTEGGVDIEEVAEKTPEKIIKFSVDPATGLQDFHMRGIAYELGFKDNQAKQMKEI
VKSVYNAFIETDAAQIEINPLIVNSDGNLLALDAKITFDDNGLFQHPNITAMRDHDEEDP
LETRAANAGLSYVKMDGNIGCMVNGAGLAMATMDIIKLYGASPANFLDVGGGADRERVKE
ALKIILSDKEVQGILVNIFGGIMRCDIIAEGIIAAAKDIGIKVPLVVRLAGTNVEKGEEI
LSNSGLEIIPAHDLADAANKIVAAIRR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgaatatcaagcaaaagagattttaagaaaatacggcgtacctacttcc
accgggctagttgttacgaaaaccgaaaagattaatgaaaccatagataacttaaatacg
gaagtatatgtggttaaagcacaaatacatgccggcggtagaggtaaagcaggcggtgtt
aaggttgttaagagtaaagaagaagccaaaaaagttgctcatgacatgtttggtattaat
ttagtaacgcgtcaaacaggacctcaaggacaaaaagtaaaccgtctttatatcgaatca
ggttgtgatattttaaaagaacattattttagtataatatttgatagatcgactagccgt
attactttcatagcttctacagaaggaggagttgatattgaagaagtggcagaaaaaact
ccggaaaaaattattaaattttccgttgatcctgcaaccggtttacaagattttcatatg
cgaggcatagcttatgagttaggctttaaggataaccaagccaaacagatgaaagaaata
gtaaaatcagtctataatgcttttattgaaaccgatgcagcacaaattgaaatcaaccca
ttaattgtaaatagcgacgggaacttattagctttagatgcaaaaattacttttgacgat
aacggcttatttcagcatccgaatattacggcaatgcgtgatcatgatgaagaagatcct
ctagaaactagagcagcaaatgcaggacttagctatgtaaaaatggacggtaatatcggt
tgtatggttaacggtgccggtcttgccatggccactatggatattattaaactttacggt
gcttcgcctgctaatttcttggatgtcggtggtggagctgatcgtgagcgtgtaaaagaa
gctttaaaaataattttatctgataaagaagtacaagggattctagttaatattttcggc
ggtatcatgcgttgtgatattatagcagaagggattattgcagctgcaaaagacataggt
ataaaagtaccgttagtagttcgtttagccggtacaaacgttgaaaaaggcgaagaaatt
ttatcaaattccggtttagaaataataccggcacatgatttagcagatgcggcaaataaa
atagttgcagcgatacggagataa

DBGET integrated database retrieval system