KEGG   Rickettsia montanensis: MCI_04110Help
Entry
MCI_04110         CDS       T01784                                 

Definition
oxidoreductase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rmo  Rickettsia montanensis
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rmo00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MCI_04110
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    MCI_04110
Enzymes [BR:rmo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     MCI_04110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
713004..713462
Genome map
AA seq 152 aa AA seqDB search
MGANFAYRFNSIATKYAIQIMKKNGFRRIVNIASAHAYVASPFKSAYVAAKHGILGLTKT
VALEVAENNITVNAICPGYVNTPLVRNQITDTAKARHISEESALRDVILKSQATKKFVEA
DKIANLVIFLCDEKASSITGSGLLIDGGWTAQ
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgggagcaaattttgcgtatagatttaatagcatcgccacaaaatacgcaatacagatt
atgaaaaaaaacggcttcaggcgaattgttaatatcgcttccgctcatgcatatgtcgca
tcacctttcaagtcggcatatgtagcagcaaaacacggtatccttgggcttaccaaaacc
gttgctttagaagtggctgagaataatattacagttaatgctatctgtcccggttacgtc
aacacaccattagtaaggaatcaaataacagatactgctaaagctagacatatcagtgaa
gaatcagcgttaagggatgtaatccttaaatctcaagctacgaaaaaatttgtagaagct
gataaaatagcaaacttagtaatattcttatgtgacgaaaaagcatcatcaataacaggt
agtggactcttgatagatggcggctggacggcacagtag

DBGET integrated database retrieval system