KEGG   Rickettsia montanensis: MCI_04345Help
Entry
MCI_04345         CDS       T01784                                 

Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
rmo  Rickettsia montanensis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rmo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MCI_04345
   00670 One carbon pool by folate
    MCI_04345
Enzymes [BR:rmo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MCI_04345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(756201..756470)
Genome map
AA seq 89 aa AA seqDB search
MGRKTFDSIPAKILKNCICIVFSRNTPLQSYNNIFLIKSLDDFWQVIKPFTDKKIFMVGG
AEIATLFLEQNLIDEFLLTKINKKQLSDL
NT seq 270 nt NT seq  +upstreamnt  +downstreamnt
atgggacgaaaaacctttgactctatacccgcaaagattttaaaaaattgtatttgtatt
gttttttcaagaaatacaccattacaatcttataataatatatttcttattaaatcttta
gatgatttttggcaggtaataaaaccttttactgataagaaaatttttatggttggaggg
gcagaaatagcgactcttttcctagagcaaaatcttattgatgaatttttacttacaaaa
ataaataaaaaacaattatcagatttataa

DBGET integrated database retrieval system