KEGG   Rickettsia montanensis: MCI_04480Help
Entry
MCI_04480         CDS       T01784                                 

Definition
Acyl-CoA desaturase 1
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
rmo  Rickettsia montanensis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rmo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MCI_04480
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    MCI_04480
Enzymes [BR:rmo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     MCI_04480
Lipid biosynthesis proteins [BR:rmo01004]
 Desaturase
  First
   MCI_04480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(777069..778277)
Genome map
AA seq 402 aa AA seqDB search
MLSKLNKPALFALIFYPIFIISLVVKYSFDYGIGLTEVIFIIASYYINNITVGIGLHRLW
SHNAYKINKYAEFVLIMLSAGTLQGPALSWASNHYKHHRYTDQDQDPHTPLKFDNKFLGF
MWSHIGWMLVGSGSYKSIDRITWAKHGKNNLLKWQLKYYWQVAAFMNIVVPLFIGYLVGG
TIQSAYAGFLFMGLGRFLQQQATFCVNSLCHFAGSKKYYKGTAGDIWWMALFLLGENWHN
YHHAFPSDYRNGTKWYHFDVHKWIIFLMSKIGLASELERTTKVRIQAKMQETLSYLSEKQ
KQKLTLMQTKIDHLLENLCLKIKELEESSITIKEQFKKSFVEIQESLKNLAEQVSSATQI
TGKPSEKLLKIVNKKIIDAEQSIYKLYNQLNTLKVSNIGIIK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgttaagtaaactaaataagcccgctttatttgctttaatattttatcctatttttatt
atatctcttgtagttaaatattcgtttgattatggaatagggctaactgaagttattttt
ataattgctagttattatattaataatattaccgttgggatcggtttgcataggttatgg
tctcataatgcctataaaataaataaatatgccgagtttgtcttaattatgctgtctgca
ggaacattacaaggaccggctttatcttgggcatcgaatcattataaacatcatagatat
acggatcaagatcaagatccgcatactcctttaaaatttgataataaatttttaggtttt
atgtggtctcatataggatggatgctagtcgggagcggtagctataagtctattgatcgc
attacttgggctaagcacgggaaaaacaatttattaaaatggcagctaaaatattattgg
caagtagcagcttttatgaatattgtcgtgcctttatttatcggttacttagtcggcggt
actatacaatcggcatatgcaggatttttatttatggggctcggtagattcctacagcag
caagcaaccttctgcgttaattctttatgccactttgccggtagtaaaaaatattacaaa
ggcactgccggagatatttggtggatggcattattcttactcggtgaaaattggcataat
taccatcatgcttttccttcagattatcgtaacggtacaaaatggtatcattttgacgtt
cacaaatggataatatttttaatgagtaaaatcggtttagcttcagaacttgaacgtact
acaaaagtacgtatacaggcaaaaatgcaagaaactttaagctatcttagtgaaaaacaa
aagcaaaaattgactttaatgcaaactaaaatagatcatttattagaaaatctatgctta
aaaattaaagagcttgaagaatcatctattactattaaagagcaatttaaaaaatctttt
gtagaaatacaagaatcacttaaaaatttagcagagcaagtaagttctgcaacgcaaata
acaggaaaaccttcggaaaaactattaaaaatagttaataaaaaaattattgatgccgaa
caatctatttataagctgtataatcaattaaataccttaaaggtatctaatataggtatt
attaaataa

DBGET integrated database retrieval system