KEGG   Rickettsia montanensis: MCI_05050Help
Entry
MCI_05050         CDS       T01784                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
rmo  Rickettsia montanensis
Pathway
rmo00020  Citrate cycle (TCA cycle)
rmo00190  Oxidative phosphorylation
rmo00650  Butanoate metabolism
rmo01100  Metabolic pathways
rmo01110  Biosynthesis of secondary metabolites
rmo01120  Microbial metabolism in diverse environments
rmo01130  Biosynthesis of antibiotics
rmo01200  Carbon metabolism
Module
rmo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rmo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rmo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rmo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MCI_05050
   00650 Butanoate metabolism
    MCI_05050
  Energy metabolism
   00190 Oxidative phosphorylation
    MCI_05050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS tRNA_anti_2 Cation_ATPase_C Fumarate_red_D
Motif
Other DBs
NCBI-ProteinID: AFC73832
UniProt: H8KBW6
Position
890962..891339
Genome map
AA seq 125 aa AA seqDB search
MVYDFKAEIVKAKNSGSAKSGSHHWLLQRVTGIILVLCSVWLIYFTLTNKNNDINIIMWE
LKKPFNVVALLITVVISLYHAMLGMRVVIEDYISCHKLRNTLIIIVQLFCIVTIVAFIVA
MFYKG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggtatatgattttaaagcagaaattgtaaaagcaaaaaatagcggttctgctaaaagc
ggttctcatcattggttattgcaaagagtaacggggattatattagttttatgttctgtg
tggctaatatattttacgttaaccaacaaaaataatgatataaatattattatgtgggag
cttaaaaagccttttaatgtagtagctttgttaattacggtggttatttcgttgtatcat
gcgatgcttggtatgcgtgtagtaattgaggattatataagttgtcacaaattacgtaat
acattgattataatagtgcaattattttgcattgtgactattgtagcttttatagtagcg
atgttttataaaggataa

DBGET integrated database retrieval system