KEGG   Rickettsia montanensis: MCI_05370Help
Entry
MCI_05370         CDS       T01784                                 

Definition
dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rmo  Rickettsia montanensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rmo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MCI_05370
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MCI_05370
  Amino acid metabolism
   00310 Lysine degradation
    MCI_05370
Enzymes [BR:rmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MCI_05370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(957525..958724)
Genome map
AA seq 399 aa AA seqDB search
MSVKIIVPSLGESVTEATIAKWYKKEGDSVKTDELLLEIETEKVTLEVNAPCNGTIGKIS
KTDGANVAVGEEIGEINEGAAANTAGTNNESAKAQAVTQPTSGKPVEKPAVANNTLAPSV
QKLVTENKLDPNNIKGTGRDGRITKGDVLETINTTATSAPAISKSNEERVQRVRMSRLRK
TIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHAVKLGFMSFFVKATIEAL
KLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVVPVVRDADKMGFAEVEKAIGILAKKA
REGKLSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDGKIEIRP
MMYIALSYDHRIIDGQEGVSFLVKIKQLIENPEKLLLNL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttaaaattatagtaccgtcgcttggggagtccgtaacggaagcaactattgcc
aaatggtataagaaagaaggcgattcggttaaaaccgatgaattactgttagaaatcgaa
accgaaaaagtgactttagaagttaatgctccttgcaacggtactataggtaaaatatcg
aaaactgacggtgcaaatgtagcagttggcgaagaaataggcgaaataaatgaaggggca
gctgcaaatactgccggtactaataatgaatctgctaaagctcaagcagtgacgcaacct
acttcaggaaagcctgtagaaaaacctgccgtggctaataatactcttgctccttctgta
caaaaattagttaccgaaaataagcttgaccccaataatataaaaggaacaggtagagac
ggtagaattaccaaaggtgacgtgcttgaaacaataaacactacggctacttctgctcct
gcaataagtaaatctaatgaagaaagagtgcagcgtgttcgtatgtcacgcttgcgtaaa
actattgcacagcgtttaaaagattcacaaaatacagcagctattttgactacttttaat
gaaatcgatatgtcaaaagtaattgctttgcgtaatcaatataaagaagagtttgagaaa
aagcacgctgtgaaacttgggtttatgtctttctttgttaaagcaacaattgaagcttta
aagcttattccgtcggtcaatgctgaaatagacggcgatgatttagtatataaaaattac
tatgatataggcgtagctgttggaacagagcaagggcttgttgtaccggttgttagggat
gccgataaaatgggatttgccgaagtggagaaagctataggaattttggctaaaaaagct
cgtgagggtaagctttctatggctgatttgtcaggtgggacattctcgatttctaacgga
ggcgtatatggctcattattatctacaccgattattaatcctcctcaatcaggtattcta
ggcttacataaaaccgaggaaagagctgtagttatagacggtaaaattgaaatacgtccg
atgatgtatatagctttatcttacgatcatcgtataattgacgggcaagaaggagtatcg
ttcttggtaaaaattaagcagcttattgagaatcctgaaaagttattgttaaatttgtaa

DBGET integrated database retrieval system