KEGG   Rickettsia montanensis: MCI_05370Help
Entry
MCI_05370         CDS       T01784                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rmo  Rickettsia montanensis
Pathway
rmo00020  Citrate cycle (TCA cycle)
rmo00310  Lysine degradation
rmo01100  Metabolic pathways
rmo01110  Biosynthesis of secondary metabolites
rmo01120  Microbial metabolism in diverse environments
rmo01130  Biosynthesis of antibiotics
rmo01200  Carbon metabolism
Module
rmo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rmo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rmo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MCI_05370
  Amino acid metabolism
   00310 Lysine degradation
    MCI_05370
Enzymes [BR:rmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MCI_05370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AFC73889
UniProt: H8KC98
Position
complement(957525..958724)
Genome map
AA seq 399 aa AA seqDB search
MSVKIIVPSLGESVTEATIAKWYKKEGDSVKTDELLLEIETEKVTLEVNAPCNGTIGKIS
KTDGANVAVGEEIGEINEGAAANTAGTNNESAKAQAVTQPTSGKPVEKPAVANNTLAPSV
QKLVTENKLDPNNIKGTGRDGRITKGDVLETINTTATSAPAISKSNEERVQRVRMSRLRK
TIAQRLKDSQNTAAILTTFNEIDMSKVIALRNQYKEEFEKKHAVKLGFMSFFVKATIEAL
KLIPSVNAEIDGDDLVYKNYYDIGVAVGTEQGLVVPVVRDADKMGFAEVEKAIGILAKKA
REGKLSMADLSGGTFSISNGGVYGSLLSTPIINPPQSGILGLHKTEERAVVIDGKIEIRP
MMYIALSYDHRIIDGQEGVSFLVKIKQLIENPEKLLLNL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttaaaattatagtaccgtcgcttggggagtccgtaacggaagcaactattgcc
aaatggtataagaaagaaggcgattcggttaaaaccgatgaattactgttagaaatcgaa
accgaaaaagtgactttagaagttaatgctccttgcaacggtactataggtaaaatatcg
aaaactgacggtgcaaatgtagcagttggcgaagaaataggcgaaataaatgaaggggca
gctgcaaatactgccggtactaataatgaatctgctaaagctcaagcagtgacgcaacct
acttcaggaaagcctgtagaaaaacctgccgtggctaataatactcttgctccttctgta
caaaaattagttaccgaaaataagcttgaccccaataatataaaaggaacaggtagagac
ggtagaattaccaaaggtgacgtgcttgaaacaataaacactacggctacttctgctcct
gcaataagtaaatctaatgaagaaagagtgcagcgtgttcgtatgtcacgcttgcgtaaa
actattgcacagcgtttaaaagattcacaaaatacagcagctattttgactacttttaat
gaaatcgatatgtcaaaagtaattgctttgcgtaatcaatataaagaagagtttgagaaa
aagcacgctgtgaaacttgggtttatgtctttctttgttaaagcaacaattgaagcttta
aagcttattccgtcggtcaatgctgaaatagacggcgatgatttagtatataaaaattac
tatgatataggcgtagctgttggaacagagcaagggcttgttgtaccggttgttagggat
gccgataaaatgggatttgccgaagtggagaaagctataggaattttggctaaaaaagct
cgtgagggtaagctttctatggctgatttgtcaggtgggacattctcgatttctaacgga
ggcgtatatggctcattattatctacaccgattattaatcctcctcaatcaggtattcta
ggcttacataaaaccgaggaaagagctgtagttatagacggtaaaattgaaatacgtccg
atgatgtatatagctttatcttacgatcatcgtataattgacgggcaagaaggagtatcg
ttcttggtaaaaattaagcagcttattgagaatcctgaaaagttattgttaaatttgtaa

DBGET integrated database retrieval system