KEGG   Rhodothermus marinus DSM 4252: Rmar_0012Help
Entry
Rmar_0012         CDS       T01119                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Rmar_0012
Enzymes [BR:rmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Rmar_0012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10232..10801
Genome map
AA seq 189 aa AA seqDB search
MPEPRIVILTAPSGAGKTTLARRLQEALPQLRFSVSATTRPPRPGERHGVDYYFLSEDEF
RRLIEQGELIEYEEVYPGRFYGTLRREIEQASRDHPVLLDIDVKGALRVKELFGDEAFAI
FVQPPSLEALAERLRNRGTEDDATLRQRLERARMELALADRFDAVVVNDDLERAAAETLR
LVRSFLERP
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgccggagccccggatcgtcatcctgaccgctcccagcggagccggcaaaaccacgctg
gcccgtcgcctgcaggaggcgctgccccagcttcgcttctcggtatcggccaccacgcgt
ccgccccgtcccggcgagcgccatggcgtggattactacttcctgtccgaagacgaattc
cggcggctcatcgagcagggcgaactgatcgaatacgaggaggtctatcccggccgcttc
tacgggacgctgcgccgggaaatcgagcaggccagccgcgaccaccccgtgctgctcgac
atcgacgtcaagggcgcactgcgcgtcaaggagctcttcggggacgaagctttcgccatt
ttcgtgcagccgccctcgctggaagctctggccgagcgcctgcgcaaccggggcaccgag
gacgacgcaacgttgcgtcagcgcttagagcgcgcccgcatggaactggctctggccgat
cgctttgacgccgtggtggtcaacgacgatctggagcgggccgcggccgaaacccttcgt
ctggtgcgctcgtttctggagcggccctga

DBGET integrated database retrieval system