KEGG   Rhodothermus marinus DSM 4252: Rmar_0121Help
Entry
Rmar_0121         CDS       T01119                                 

Definition
zinc-binding alcohol dehydrogenase family protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Rmar_0121
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rmar_0121
  Lipid metabolism
   00071 Fatty acid degradation
    Rmar_0121
  Amino acid metabolism
   00350 Tyrosine metabolism
    Rmar_0121
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rmar_0121
   00626 Naphthalene degradation
    Rmar_0121
Enzymes [BR:rmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rmar_0121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
131391..132407
Genome map
AA seq 338 aa AA seqDB search
MTRALPATMRAMVLEAPGRPLVLRELPVPAPGPGEVLLRVEACGVCRTDLHIVDGELPEP
KLPLIPGHQIVGRVVRLGEGVTRFREGDRVGVPWLAETCGTCRYCRRGQENLCPNACFTG
YTRDGGFAEFTTALADYCYSLPDDVYDAPHAAPLLCAGLIGYRTYRLAGPHVERLGLYGF
GAAAHLIIQVAVARGQQVYAFTRPGDTAAQDFARKLGAVWAGASTERPPEPLDAALIFAP
VGALVVEALRSVDKGGVVVCGGIHMSDIPSFPYRLLWEERVIRSVANLTRQDGEEFLKLA
PTIPVRTEVTCFPLEEANEALRRLREGQLQGAAVLVMG
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtgcgctgcctgctaccatgcgggccatggtgctggaggcccccggacgcccg
ctcgtgcttcgcgaactgcccgtgcccgcacccggcccgggcgaagtgttgcttcgggtg
gaagcgtgcggcgtgtgccgtaccgatctgcacatcgtggatggcgagttgcccgagccc
aagctgccgctgatcccgggccaccagattgtggggcgggtggtgcgattgggtgaaggc
gtgacccgctttcgggagggcgaccgcgtgggcgtgccctggctggccgaaacatgcgga
acgtgccgctactgccgtcgcggccaggagaacctgtgtccgaacgcctgcttcaccggc
tacacgcgcgacggtggctttgccgagttcaccacggctcttgccgactactgctattca
ctccccgacgacgtgtacgacgcgccgcacgcggcaccgctgctgtgtgccgggttgatc
ggctaccgcacctaccggctggccggaccgcacgtcgagcgcctgggtctgtacggcttt
ggcgcggccgcgcatctgatcatccaggtggccgtggcccgcggccagcaggtctacgca
ttcacccggcctggcgacacggccgcgcaggattttgcccgaaaactgggagccgtctgg
gccggtgcctcgacggagcgtccgccggagccgctcgatgccgcgttgatcttcgcaccg
gtaggggcgctggtggtcgaggcgttgcgctcggtggataagggcggcgtggtggtgtgc
ggcgggatccacatgagcgacatcccttcgtttccctatcggctcctctgggaggagcgc
gtcattcgctcggtggccaacctgacgcgccaggacggtgaggaatttctgaagctggcg
cccaccattcccgtacgtaccgaggtcacgtgtttcccgctggaagaggccaacgaggcg
cttcggcgactccgcgaaggccagctccagggcgccgccgtgctggtgatgggatag

DBGET integrated database retrieval system