KEGG   Rhodothermus marinus DSM 4252: Rmar_0145Help
Entry
Rmar_0145         CDS       T01119                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rmar_0145
Enzymes [BR:rmr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Rmar_0145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
160727..161662
Genome map
AA seq 311 aa AA seqDB search
MWQPEAFDTDRFVLNCRGRLLDCRPGLPGGAHVMGILNVTPDSFWDGGRYQTVDAALKRV
ETMLEEGAAIIDVGGESTRPRGRAYGRGAEPVSPDEERRRVLPVIEAIAQRFPEAIISVD
TYKPEVARDALEAGAHLINDQTGLRLYPEMAEVAARYGAPLVLMHSVGRPGEMPHESHYD
DVVAEVRQSLAESVARAHAAGVRQVVLDPGFGFGKTAAENLQLINNVDALLSLGYPVLVG
ISRKSTIGQVLGTPEQPVPPEGRLYGTLGVTAVAVLRGATLVRAHDVRPTVEMLRLLAAT
LAQPRTELHAV
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaacctgaagccttcgatacagaccgattcgtgctgaactgccgggggcggctg
ctggactgtcggcccggcctgcccggcggggcgcatgtgatgggcattctgaacgtgacg
cccgactcgttctgggacggcggccggtatcagacggtggatgccgccctgaagcgggtg
gaaaccatgctcgaagaaggggcggcgatcatcgatgtggggggtgaatcgacacggccg
cgcgggcgcgcctacggccggggtgccgagccggtctcgcccgacgaagagcggcggcgc
gtgcttccggtgatcgaggcgatcgcgcagcgttttcccgaagcgatcatttcggtcgat
acttacaagcccgaggtggcgcgtgatgcgctggaagccggtgcgcacctgatcaacgat
cagaccgggctccggctctatccggagatggccgaggtggccgcccgctacggcgcgccg
cttgtgctcatgcactcggtcgggcgtccgggcgagatgccgcacgagtcgcactacgac
gacgtggtggccgaagtccggcaatcgctggccgaatcggtcgcccgagcccacgccgcc
ggcgtgcgtcaggtggtgcttgatccgggctttggcttcggcaagacggcggccgaaaac
ctgcagttgatcaacaacgtcgatgcgctcctgagtctgggctatcccgtgctggtgggc
atctcccgcaaaagcacgatcggtcaggtgctgggcacgcccgagcagcctgtcccgccc
gaagggcggctctacgggacgctgggggtgacggccgtggccgttttgcgcggggccacg
ctggtgcgggcgcacgacgttcgccccactgtcgaaatgctgcggctgctggcggccacc
ctggcgcaaccgcgcactgaattgcacgccgtctga

  All links  
No link information was found.   
DBGET integrated database retrieval system