KEGG   Rhodothermus marinus DSM 4252: Rmar_0147Help
Entry
Rmar_0147         CDS       T01119                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rmr  Rhodothermus marinus DSM 4252
Brite
Enzymes [BR:rmr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Rmar_0147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
162484..163167
Genome map
AA seq 227 aa AA seqDB search
MIEDDPLYRRRRLRLVEALREKGIQDERVLEAIARVPRHLFVEPALRARAYDDVALPIGL
KQTISQPFTVAYQTQLLEVRPGDRVLEIGTGSGYQAAILCALGARVFTIERHRPLLERAL
ARLEALGYRVVARCGDGSQGWPAFAPFDGIVVTAGATEVPEALCEQLRVPEGDRPGGRLV
IPVGSSHQQRMVRVRCTGPGTYETETLHVFRFVPLVRGSDEARRRQS
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaggacgatcccctgtaccgacggcggcgcctgcgtctggtggaggcgctgcgg
gagaagggcattcaggacgagcgcgtgctggaggccatcgcccgggtgccccgtcatctg
ttcgttgaacccgcgctgcgcgcccgtgcctacgacgatgtggctctgccgatcggcctg
aagcagaccatttcgcaacccttcacggtggcctatcagactcagctcctggaggtgcgg
ccgggcgatcgcgtgctggagatcggcacaggcagcggctaccaggcggccattctgtgc
gcgctgggggcccgtgtgttcacgatcgagcggcatcggccgctgctggagcgggccctt
gcccgcctggaggcgctgggctaccgggtggtggcccgctgcggcgacggctcgcagggc
tggccggctttcgctccgttcgacgggatcgtcgtgacggccggcgcgacggaagttccg
gaggctctgtgcgagcagcttcgggtgcccgagggcgaccgccccggtgggcgcctggtc
ataccggttggcagcagccatcagcaacgcatggtgcgcgtgcgctgcaccggtcccggc
acgtacgaaaccgaaacgctgcacgtcttccggttcgtgccgcttgtgcgcgggagtgac
gaggcgcggcgacgtcagtcctga

DBGET integrated database retrieval system