KEGG   Rhodothermus marinus DSM 4252: Rmar_0193Help
Entry
Rmar_0193         CDS       T01119                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rmr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
206653..207315
Genome map
AA seq 220 aa AA seqDB search
MAKNKSTGVLVRSGAHLELDSHPIDHYERVDRYPAEATEAIQQHVREILRWIGEDPDREG
LRRTPERVALALQYLTQGYHQDPRAILEAALFEEDYSEMILVRDIQIYSLCEHHLLPFFG
KAHVAYIPNKKIVGLSKIPRVVDVFARRLQVQERLTIQIRDALEEVLQPLGVAVVIEAQH
LCMMMRGVEKQHAITTTSAMSGEFLKEATRAEFMRLINGG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaataaatcgaccggcgtacttgtgcgctcgggcgctcatctagagctggac
agccacccgatcgatcactatgagcgggtggatcggtatccggccgaggcgaccgaggcc
atccagcagcacgtgcgagagatcctgcgctggatcggcgaagatccggatcgcgaaggg
ctgcggcgcactccggagcgggttgcgctggcgctccagtatctgacgcaggggtatcac
caggatccgcgggccatcctggaggcggccctcttcgaggaagactacagcgagatgatc
ctggtgcgggacattcagatctactcgctctgcgagcatcacctcttgccgtttttcggg
aaggcgcatgtggcttacatcccgaacaaaaagatcgtcggactgagcaaaattccccgc
gtggtggacgtgttcgcccggcggcttcaggtgcaggagcggttgacgatccagatccgg
gatgcgctggaagaggtgcttcagccgctgggtgtggccgtggtgatcgaggcgcagcac
ctgtgcatgatgatgcgcggcgtggaaaaacagcatgcgatcaccacgaccagtgcgatg
agcggcgagtttctgaaagaggccacgcgggccgagttcatgcggctgatcaacggagga
tga

DBGET integrated database retrieval system