KEGG   Rhodothermus marinus DSM 4252: Rmar_0193Help
Entry
Rmar_0193         CDS       T01119                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rmar_0193
Enzymes [BR:rmr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Rmar_0193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
206653..207315
Genome map
AA seq 220 aa AA seqDB search
MAKNKSTGVLVRSGAHLELDSHPIDHYERVDRYPAEATEAIQQHVREILRWIGEDPDREG
LRRTPERVALALQYLTQGYHQDPRAILEAALFEEDYSEMILVRDIQIYSLCEHHLLPFFG
KAHVAYIPNKKIVGLSKIPRVVDVFARRLQVQERLTIQIRDALEEVLQPLGVAVVIEAQH
LCMMMRGVEKQHAITTTSAMSGEFLKEATRAEFMRLINGG
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaataaatcgaccggcgtacttgtgcgctcgggcgctcatctagagctggac
agccacccgatcgatcactatgagcgggtggatcggtatccggccgaggcgaccgaggcc
atccagcagcacgtgcgagagatcctgcgctggatcggcgaagatccggatcgcgaaggg
ctgcggcgcactccggagcgggttgcgctggcgctccagtatctgacgcaggggtatcac
caggatccgcgggccatcctggaggcggccctcttcgaggaagactacagcgagatgatc
ctggtgcgggacattcagatctactcgctctgcgagcatcacctcttgccgtttttcggg
aaggcgcatgtggcttacatcccgaacaaaaagatcgtcggactgagcaaaattccccgc
gtggtggacgtgttcgcccggcggcttcaggtgcaggagcggttgacgatccagatccgg
gatgcgctggaagaggtgcttcagccgctgggtgtggccgtggtgatcgaggcgcagcac
ctgtgcatgatgatgcgcggcgtggaaaaacagcatgcgatcaccacgaccagtgcgatg
agcggcgagtttctgaaagaggccacgcgggccgagttcatgcggctgatcaacggagga
tga

DBGET integrated database retrieval system