KEGG   Rhodothermus marinus DSM 4252: Rmar_0195Help
Entry
Rmar_0195         CDS       T01119                                 

Definition
nicotinate phosphoribosyltransferase
Orthology
K00763  
nicotinate phosphoribosyltransferase [EC:6.3.4.21]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rmar_0195
Enzymes [BR:rmr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.21  nicotinate phosphoribosyltransferase
     Rmar_0195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(208022..209383)
Genome map
AA seq 453 aa AA seqDB search
MHWVTDENAVLFTDLYELTMLQAYYREGLDTAVATFDLFVRQTPGRNYLLACGLDTVLHY
LETLHFTQEALDYLASLGRFEPDFLDYLARFRFTGDVYAVPEGTPVFAGEPLLQVVAPIG
QAQLIETFVLNQITFQTGIASKASRVVQAAQGRLVADFGARRMHGADAALKAVRAYYIAG
IQATSLVLGGQMFGVPVTGTMAHSYVEAHPTEEDAFRAFAGLYPGTTLLVDTYDTLEGVR
KVIALCKEQGDRFQVGAIRIDSGDLAALAKEARRMLDEAGLTHIKIFASGSLDEYRIAEL
LAQGAPIDGFGVGTRMGTISDRPYLDSAYKLSEFEGEGRMKLSLEKANLPGRKQVFRFYG
EDGRATHDVIACHDEQLEGGEPLLHCVMRGGRRTEAGRDTLEAARERARQDLARLPERLL
ALEEADPPYPVHISERLQTLGEAVRHRLMQQET
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcactgggtaaccgacgaaaacgccgtgctgtttaccgatctgtacgagctgactatg
ctccaggcctactaccgggaaggcctggacacggctgtagcgacgtttgacctgttcgtg
cgccagacgcccggccgcaactatctgctggcctgcggcctcgatacggtgctccactac
ctggagacgctgcacttcacgcaggaagcgctcgactacctggcctcgctggggcgcttc
gaaccggactttctggactacctggcacgcttccgcttcacgggcgacgtgtacgccgtg
cccgaggggacgccggtctttgccggggaaccgctgctccaggtggtagcacccatcgga
caggcccagctcattgaaaccttcgtgctcaaccagatcaccttccagacgggcatcgcc
tcgaaggccagccgggtcgtgcaggcggcacaggggcggctcgtggccgacttcggtgcc
cgccgcatgcacggcgccgacgctgcgctgaaggcggtccgtgcctattatatcgctggc
atccaggccacctcgctggtgctgggcggccagatgttcggggtgcccgtcaccggcacc
atggcgcacagctacgtcgaagcccaccccacggaagaggacgccttccgggcattcgcc
ggcctttaccccggcacgacgctgctggtggatacctacgacacgctggaaggcgtccgg
aaggtcattgccctctgcaaagaacagggcgaccggtttcaggtaggggcgatccggatc
gattcgggcgacctggccgcgctggcgaaggaagcgcgacgcatgctggacgaggccggc
ctgacgcacatcaagatctttgccagcggcagcctcgacgaataccgcattgccgagctg
ctggcccagggtgcgcccatcgacggcttcggagtgggcacgcgcatgggcaccatcagc
gaccgcccctacctcgacagcgcctacaagctcagcgagttcgagggcgaggggcgcatg
aagctgtcgctggaaaaagccaacctgcccggacggaaacaggtctttcgcttctatggc
gaggacggacgtgccacccacgacgtgatcgcctgccacgacgagcagctggaaggcggc
gagccgctactgcactgcgtgatgcggggcggccggcgcaccgaagccggtcgcgatacg
ctggaggcggcccgcgagcgcgcccgccaggacctggcccgcctgcctgaacggttgctt
gcgctcgaagaagccgatccgccctacccggtgcacatcagcgaacggctgcagacgctg
ggcgaggccgtccgccaccgactgatgcagcaggaaacctga

DBGET integrated database retrieval system