KEGG   Rhodothermus marinus DSM 4252: Rmar_0209Help
Entry
Rmar_0209         CDS       T01119                                 

Definition
hypothetical protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rmar_0209
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rmar_0209
   00650 Butanoate metabolism
    Rmar_0209
  Energy metabolism
   00190 Oxidative phosphorylation
    Rmar_0209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
222051..222554
Genome map
AA seq 167 aa AA seqDB search
MAIQYGKTSRSYATNWFLHRITGTFLVFLLITHFWVQHYDAQTASVAAQVLSSEQIEAGA
LPDYPEAAKEAVRARYGPDAEVTPYDVVMLRLADPVYAVLWKGFNILFLIFALHHGFYGL
NNILTDYIRNPIGRVLAQTLSWTLALALLIVGLYSIIVAGWGYVPAS
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggctatccagtacggcaagacgtcccgatcctatgcgacgaactggtttctgcaccgg
attaccgggacgtttctggtgtttctgctgatcacgcatttctgggtgcagcactacgat
gcgcagacggccagcgtggcggcccaggtgctctcgagcgaacagatcgaggccggcgcg
ctgcccgactatccggaggcggccaaagaggcggtgcgggcccgctacggccccgacgcc
gaagtcacgccctacgacgtggtgatgctccggctcgccgatccggtctatgccgtgctc
tggaagggattcaacatcctgtttctgattttcgcgctgcatcacgggttctacgggctc
aacaacatcctgaccgactacatccgcaatccgatcgggcgcgtgctggcccagacgctc
tcctggacgctggcgctggcgctgctcattgtggggctgtactccatcatcgtagccggc
tgggggtacgtgcctgcatcgtga

DBGET integrated database retrieval system