KEGG   Rhodothermus marinus DSM 4252: Rmar_0296Help
Entry
Rmar_0296         CDS       T01119                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rmar_0296
   01230 Biosynthesis of amino acids
    Rmar_0296
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rmar_0296
   00030 Pentose phosphate pathway
    Rmar_0296
   00051 Fructose and mannose metabolism
    Rmar_0296
   00052 Galactose metabolism
    Rmar_0296
  Energy metabolism
   00680 Methane metabolism
    Rmar_0296
Enzymes [BR:rmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Rmar_0296
Protein phosphatases and associated proteins [BR:rmr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Rmar_0296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
323989..325116
Genome map
AA seq 375 aa AA seqDB search
MPRRLRIGLLTGGGDCPGMNAVIRAVTKSLILQANAEVIGFEDGYEGLIEGRFRTLEFQD
VSGILTRGGTILGTSNRANPFRYYRRGEADVSAEVIALYRELELDGIVAIGGDGTMTIAH
GLSERGLRFIGVPKTIDNDIWGTERTFGFDTAVHIATEAIDRLHTTAQSHHRVMICETMG
RYAGWIALYAGVAAGADVILIPELPFDVEVVAEVCRERESDGHRFTIIVVAEGARPEGGT
FHVRERVPESPDPIRLGGIGYELERQLRDRLRSEVRTTVLGHVQRGGTPTAYDRSLASAF
GAYAAALVQAEQYGCMVALRDGRLTTVPLAEVAGRTRTVPLDHPMLGAALAVGTSLGVRA
LTSPLVGAEPTTPLA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgacgtttacgcatcggcctgctgaccggcggcggcgattgcccgggcatgaac
gccgtcatccgtgccgtcaccaagagtctgatcctgcaggccaacgccgaggtgatcggc
ttcgaagacggctacgaaggactcatcgaaggtcgatttcggacgctcgaatttcaggac
gtcagcggcatcctgacgcggggtggtacgattctcggcacgagcaatcgggccaatccg
tttcgctactaccggcgcggcgaggccgacgtgtcggccgaagtcattgccctgtaccgc
gagctggagctggacggcatcgtggccatcggcggcgacggcacgatgacgatcgcccac
gggctctcggagcggggccttcgattcatcggcgtgcccaagacgatcgacaacgacatc
tggggtaccgagcgcaccttcgggttcgatacggccgtgcacatcgccacggaggcgatc
gaccggctccacacgacggcgcagagccatcaccgcgtgatgatctgtgagacgatgggg
cgttatgccggatggatcgcgctgtatgcgggcgtggcggccggcgccgacgtaattctg
attcccgagctgcccttcgacgtggaggtggtggccgaggtgtgccgtgagcgcgaaagc
gacggccatcgtttcacaatcattgtggtggccgaaggggcgcgccccgagggcggcacg
tttcacgtgcgggagcgcgtgcccgaaagccccgacccgatccggctgggcggcattggc
tacgaactggagcgtcagctccgtgatcgtctgcggagcgaggtgcgcaccaccgtgctg
ggccacgtgcagcggggcggcacgcccacggcctacgaccggagcctggcctcggccttc
ggggcctatgcggccgcactggtgcaggccgagcagtacggctgcatggtggcgctgcgc
gacggccggctgaccaccgtcccgctggccgaagtggccggacgcacgcgcaccgtgccg
ctcgaccaccccatgctgggggccgcactggctgtgggtacgtcgctgggcgtccgggcg
ctgacctcgccgctggtgggcgccgagccgaccacgccgctggcctga

DBGET integrated database retrieval system