KEGG   Rhodothermus marinus DSM 4252: Rmar_0438Help
Entry
Rmar_0438         CDS       T01119                                 

Definition
xylose isomerase domain-containing protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:rmr00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:rmr00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
482375..483526
Genome map
AA seq 383 aa AA seqDB search
MANAQTFHSICRWTFNAGKGGFVPANIRPAWAADRFGTVEFIYLVKEKIAPRLPDTITLG
VELHYDNEINEQNAEAVAKALAETGLHLAMITPGAHIHFGYGGICSLDPKERAAAEELGR
RTVELAYGPLRKAWHPDSDKAPTLVIWNGSFGYDLATVGVRQMYRNLKESLARLCQLEQE
KGGLMYIGIEPKPNEGHPAMLLPTVASALLIWRQLADEFGIDRSKKGVNMEIGHSEMIGL
DAVYDVVEQLEERAMVHFHLNSQGYNDGIILGGPGRYDIDHGTRVNGMNIALAGLLEQDG
YNRWLGHDMQPRPYDNEEQAIDRVVRSILSWEACRRAAQQLDVSELLALLARRETARAED
LMRAALVEAQRQFDALYEPTVSA
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacgcacagaccttccacagcatctgtcgctggacgttcaatgcgggcaagggc
ggcttcgtcccggccaacattcgtccggcctgggcggccgatcgcttcggcacggtcgag
ttcatctatctggtgaaagaaaagattgcaccacgcctgcccgacacgataacgctgggc
gtcgagctgcactacgacaacgaaatcaacgagcagaacgccgaggcggtcgcgaaggcg
ctggccgagaccgggctgcatctggcgatgatcacgccgggcgcccatattcatttcggc
tatggcgggatctgctcgctcgatccgaaggagcgggcggccgccgaagaactgggccgg
cgcacggtggagctggcctacggtccgctgcgcaaggcctggcatccggactccgacaaa
gcgcccacgctggtcatctggaacggctcgttcggctacgacctggccacggtaggggtg
cgccagatgtaccgtaacctgaaggaaagcctggcgcgtctctgccagctcgagcaggaa
aaaggcgggctcatgtacatcggcatcgagcccaagccgaacgaagggcatccggccatg
ctgttgccgaccgtggccagtgcgctgctcatctggcgccagctcgccgacgagttcggc
atcgatcggtcgaagaaaggagtcaacatggaaatcggtcactcggagatgatcggcctc
gatgccgtttacgatgtggtggagcagctcgaagaacgggccatggtccatttccacctg
aacagccagggctacaacgatggtatcattctgggcggtccggggcgctacgacatcgac
cacggcacgcgcgtcaacggcatgaacatcgcgctggccggtctgctggagcaggacggg
tacaatcgctggctcgggcacgacatgcagccccggccctacgacaacgaggagcaggcc
atcgatcgcgtggtgcgcagcattctgagctgggaagcctgccgccgcgccgcgcagcag
ctcgacgtgtcggagctgctggcgctgctggcccggcgcgagacggcccgcgccgaagat
ctgatgcgggcggcgctggtcgaggcgcagcgtcagttcgacgcgctctacgagccgacc
gtcagcgcctga

DBGET integrated database retrieval system