KEGG   Rhodothermus marinus DSM 4252: Rmar_0474Help
Entry
Rmar_0474         CDS       T01119                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rmar_0474
   00052 Galactose metabolism
    Rmar_0474
Enzymes [BR:rmr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Rmar_0474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
521895..523046
Genome map
AA seq 383 aa AA seqDB search
MRTFWLVLCGGLLFGCQPSSNETPSPVEATTVTVTEESFGQLPDGRPVTLFRLRNASGME
VEVLNYGAIIRAIRVPDREGNPGDVVLGFDSLAAYLQPHPYIGAVVGRYANRIGGARFVL
DGQTYELAANDGPNHLHGGLKGFDKVLWEAEPFTNGNEAGVRLTYVSPDGEEGYPGTLRA
TVTYTLADSNALVIDYEATTDKPTIVNLTQHAYFNLAGRGDILNHELQLFADFYTPVDER
LIPTGEICPVAGTPLDFRTPQRIGARIDADHEQIRRGRGYDHNFVLRHTERGALELAARV
YEPTTGRIMRVYTTEPGIQFYSGNFLDGSLTGKGGMVYARRTGFCLETQHFPDSPNKTHF
PSPVLRPGETYRSRTVYAFDVAE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcgaacgttctggctcgtgctctgcggggggctgctgtttggttgtcagccttcgtcc
aacgaaaccccttcgcctgtggaagcgacaacggtaaccgtcaccgaggaatcgtttggc
cagttgcccgacggacggcctgtcacgcttttccggctacgcaatgccagcgggatggaa
gtcgaagtcctgaattacggggcgatcatccgggccattcgggtgcccgatcgcgagggg
aacccgggcgatgtggtgctgggcttcgacagtcttgcagcctatctgcaaccccatcct
tacatcggggcagtggtcggtcgctatgccaaccgcatcggcggggcccgcttcgtgctc
gacggccagacctacgagctggcggccaacgatggccccaaccacctgcacggcgggctg
aaaggcttcgacaaagtgctctgggaggctgagccgttcacgaatgggaacgaagccggt
gtgcgcttgacgtacgtgagtcccgacggtgaggagggctatccgggcacgctgcgggcg
acggttacctacacgctggccgattcgaacgcgctcgtgatcgactacgaggcgaccacc
gacaaacccaccatcgtcaacctgacgcagcatgcctacttcaacctggccggtcgcggg
gacatcctgaaccatgaactgcagctctttgccgatttctacacgccggtagacgagcgg
ctgattcctaccggcgaaatatgcccggtggcgggcacgccgctggactttcgcaccccg
cagcgcatcggtgcgcgcatcgacgccgaccacgagcagatccgtcgcggccgtggctac
gaccacaacttcgtgctgcgccacaccgaacgcggcgcgctggagctggccgcccgcgtc
tacgagcccaccaccggccgcatcatgcgcgtctacaccaccgagccgggcattcagttc
tacagcggtaacttcctggacggctcgctgaccggcaaaggcggcatggtgtacgcccgg
cgcaccggcttctgtctggagacgcagcattttccggattcacccaacaagacgcatttt
ccgtcaccggtgctgcgtccgggtgagacctaccgctcgcgtacggtttacgccttcgac
gtggccgagtag

DBGET integrated database retrieval system