KEGG   Rhodothermus marinus DSM 4252: Rmar_0540Help
Entry
Rmar_0540         CDS       T01119                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Rmar_0540
Enzymes [BR:rmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Rmar_0540
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Rmar_0540
Lipid biosynthesis proteins [BR:rmr01004]
 Fatty acid synthase
  Component type
   Rmar_0540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(613209..613967)
Genome map
AA seq 252 aa AA seqDB search
MYRFDLLITGLTDSVLKLLLLPLLMLLAACGGAPEPPRSEASPDTTAPAVRNTARAERTI
NVLVLGNSLAAGYGLSPDEAFPAVLQRKVDSLGWPVRIINAGLSGETSAGGLRRIEWLLR
ERIDVLILELGANDGLRGIDPEVTRRNLQGIIDKVRARYPDADIILAGMQLPPNLGPDYT
AAFRAIYPELARANDAHLIPFLLEGVGGVPELNQADGIHPTAEGQRIVAENVWRVLRPVL
ERQLSRPTRNAS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtacagattcgacctccttataaccggtctgaccgattcggttctgaaactgctcctt
ttgccgctgctcatgctgctggccgcctgcggcggcgcgcctgaaccgccccgatctgaa
gcttcgcctgatacgacggccccggccgtccgcaacaccgcccgcgcggagcgcacgatc
aacgtgctcgtgctgggcaacagtctggccgccggctacggtctgtcgcctgacgaagcc
tttccggccgtgttgcagcgcaaagtggattcgctgggatggcccgtgcgcatcatcaac
gccgggctgagcggcgagacctcggccggtggcctgcgccgcatcgagtggctgctccgc
gaacgcatcgacgtgctcattctggaactgggcgccaacgacgggctgcgcggcatcgac
cccgaagtgacgcgccgcaacctgcagggcatcatcgacaaagtgcgcgcccgctatccg
gacgccgacatcatcctggccggcatgcaactgcccccgaacctgggccccgactacacg
gccgccttccgcgccatctatcctgaactggcccgcgccaacgacgcccatctgattccc
ttcctgctcgaaggcgtcggaggcgtgcccgagctcaaccaggccgacggcattcatccc
acggccgaaggtcagcgcatcgtggccgaaaacgtctggcgcgtgctgcgccccgtgctg
gagcgacagctttcgcggccgactcgaaacgcatcgtga

DBGET integrated database retrieval system