KEGG   Rhodothermus marinus DSM 4252: Rmar_0666Help
Entry
Rmar_0666         CDS       T01119                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rmar_0666
  Amino acid metabolism
   00340 Histidine metabolism
    Rmar_0666
Enzymes [BR:rmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Rmar_0666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
762542..763873
Genome map
AA seq 443 aa AA seqDB search
MELLPIVPYEQRAERLAALWARGGTFDPEIERAVQEILQQVQQQGDAALLALTERFDGVR
PPSLRVPEAELAAAYEAMDPELKAIIAEAADNIRRFHEHQRRTSWFVEDGDGVVLGQRIV
PLERVGLYVPGGRAFYPSSLLMNAIPAQVAGVPELHLVSPPGPSGWPHPLVLATAHFLGI
RHVYAVGGAQAVAALAFGTETIPRVDKIVGPGNAYVALAKKMVFGRVDIDAVAGPSEIVV
LADDTADPEFVAADLLSQAEHDERASAVLVTPHELLAEAVRARVQRMVAEAPRRAILEVS
LARYGACIVTPSMTEAYAVVNELAPEHLELIVRDPWAALPHIRHAGAIFLGPFSTEPVGD
YFAGPNHVLPTGGTARYASALSVDDFVRSQSIIAYTAERLRRTGPRIMRFAEAEALPAHA
QAVAVRLARLAEQAPDSAVRSSA
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggaactgcttcccatagtcccctacgaacagcgcgccgagcggctggcggcgctctgg
gcgcgtggcggcacgttcgatccggaaatcgagcgggccgtgcaggagatcctgcagcag
gtgcagcagcagggtgacgccgcgctgctggcactgaccgagcgattcgacggggtgcgt
ccgccatcgctccgggtgccggaagcggagctggcggccgcgtacgaggccatggacccc
gagctgaaggccatcattgccgaggcggccgacaacatccggcgcttccacgagcaccag
cggcgcacgtcgtggttcgtcgaggacggtgacggcgtggtgctgggccagcgcatcgtg
ccgctggagcgggtgggactctacgtgccgggcggccgcgcgttctacccctccagtctg
ctgatgaacgcaatcccggcacaggtggccggcgtgccggagctgcatctggtctcgccg
ccggggccttccgggtggccgcatccgctggtgctggccaccgcccactttctgggtatt
cgtcatgtgtatgccgtgggtggagcgcaggcggtggcggcgctggccttcggtacggag
acgatcccgcgggtggataaaatcgtggggccgggcaatgcctacgtggcgctggccaag
aaaatggtcttcgggcgggtggacatcgacgccgtagccggccccagtgagatcgtcgtg
ctggccgacgacacggccgatccggagttcgtggcggccgacctgctctcgcaggccgag
cacgacgagcgggcttcggccgtgctggttacgccgcacgagctgctggccgaggcggtc
cgggcacgcgtgcagcgcatggtggccgaggcgcctcgtcgcgcgatcctagaggtgtcg
ctggcacgctacggcgcctgcatcgtgacaccgtcgatgaccgaagcgtacgcggtggtc
aacgagctggcgcccgagcacttggagctgatcgttcgggatccctgggcggcgttgccg
cacatccgccatgccggggccatctttctgggtccgttttcgacggagccggtgggcgac
tactttgccggacccaaccacgtattgcccaccggcggcacggcccgctatgcctcggcg
ctgagtgtggacgacttcgtgcggagtcagtcgatcattgcctacacggccgagcggctg
cgccggaccggtccgcgcatcatgcgcttcgccgaagccgaggcgttgccggcgcacgcc
caggcggtggccgtccggctggcccggctggcggaacaagcgccggattccgccgtgcgt
tcgtctgcctga

DBGET integrated database retrieval system