KEGG   Rhodothermus marinus DSM 4252: Rmar_0723Help
Entry
Rmar_0723         CDS       T01119                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Rmar_0723
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rmar_0723
Enzymes [BR:rmr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Rmar_0723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
837814..838776
Genome map
AA seq 320 aa AA seqDB search
MSTSADTPLQGRLRHRHLLGLATYSAEEIQLILQTARQFREVLERPIRRVPTLRGVTVVN
LFFEPSTRTRISFELAEKRLSADVVNFSAAGSSVVKGETLKDTARNLEAMKIDMVVIRHR
SPGAAHFLTRCIDAVVINAGDGAHEHPTQALLDLLTISDHFPSFEGLNVSIIGDIAHSRV
ARSNIYGLKALGANVTLCGPRTLMPVGIEELGVRVTYRLEEALEGCDVAMALRLQLERQT
AGLFPSLREYHERYGIKLEHLERYPDLLVMHPGPVNRGVELASEVVDHERAIILNQVTNG
VAVRMAVLYLLAGMPEAVAA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgtcagccgatacgccgcttcagggccggctccggcaccgacacctgctgggg
ctggccacctattccgccgaggagattcagctcattctgcagacggcccgccagtttcgg
gaagtgctcgaacgccccatccggcgtgtgcccacgcttcggggcgtgacggtggtcaac
ctgtttttcgaaccgtccacgcgcacgcgcatctcgttcgagctggccgaaaagcgcctg
tcggccgacgtggtcaacttctcggcggcgggctcgtcggtggtcaagggcgaaacgctc
aaagacacggcccgcaacctggaagccatgaagatcgacatggtcgtcatccggcatcgc
tcgccgggggcggcccattttctcacgcgctgcatcgacgccgtcgtcatcaatgcgggc
gacggtgcgcatgagcatccgacgcaggcgctgctggatctgctgaccatctcggaccat
ttcccgtcgttcgaagggctgaacgtctcgatcatcggcgacatcgcgcatagccgggtg
gcccgctccaacatctacggcctgaaggcgctgggagcgaacgtgacgctctgcgggccg
cgcacgctcatgccggtgggcatcgaggagctgggcgtgcgcgtcacttaccggctggaa
gaagcgctggagggctgcgacgtggccatggcgctgcggctgcagctcgaacgccagacg
gccgggctgttccccagcctgcgcgagtaccacgagcgctacggcatcaagctggagcac
ttagagcgctacccggacctgctcgtcatgcacccgggacccgtcaaccggggcgtcgag
ctggccagcgaggtcgtcgatcacgagcgggccatcatcctgaatcaggtcaccaacggc
gtggccgtgcggatggccgtgctctacctgctggccggtatgcccgaggcggtcgccgca
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system