KEGG   Rhodothermus marinus DSM 4252: Rmar_0806Help
Entry
Rmar_0806         CDS       T01119                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:rmr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(924236..925258)
Genome map
AA seq 340 aa AA seqDB search
MEMQTTQSVTLSLIERPRRLRRTEAIRRMVRETRLSVDQLVAPLFVVEGHGVRQEVPSMP
GQYRLSIDELVREARELHALGIPAVALFPALDESLKTPDGREAFNPDGLYPRAIRAVKEA
VPELLVITDVALDPYSSDGHDGIVRDGRILNDETVEILARMAVVQAQAGADIVAPSDMMD
GRVGAIRRALDEAGFTEVAILSYTAKYASAFYGPFRDALDSAPRHRPGVPPDKKTYQMDP
ANAREALRELRLDLEEGADMVMVKPALPYLDVIYRVKQASDVPVAAYHVSGEYAMLKAAA
LNGWLDEKAAVLEALTAICRAGADVILTYFAKQVAQWLQK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgcaaacgacacagagcgtgacgctttcgctgatcgagcgtccccgtcggttg
cgccggaccgaagccatccggcgcatggtgcgcgaaacgcgcctgtcggtggaccagctc
gtagcgccgctgttcgtcgtcgagggccacggcgtgcgccaggaagtgccctcgatgccg
ggccagtaccggctcagcatcgacgaactggtacgggaggcgcgggagctgcacgcgctg
ggcatcccggccgtggcgttgtttccggcgctggacgaatcgctcaagacgcccgacggc
cgcgaggcgttcaacccggacggcctctatccccgggccatccgggcagtcaaggaggcc
gtgcccgagctgctggtcatcaccgacgtggcgctggacccctactcgtcggatggtcac
gacggcatcgtacgcgacggccgcattctcaacgacgagacggtggagatcctggcccgg
atggccgttgtgcaggcgcaggccggcgccgacatcgtggccccctcggacatgatggac
ggccgcgtgggcgccatccgccgggcacttgacgaagccggcttcaccgaagtggcgatt
ctctcctacacggccaaatacgcctcggccttctacgggcccttccgggatgcgctcgac
tcggccccgcgccatcggcccggcgtcccgccggacaagaaaacctaccagatggacccg
gccaacgcccgtgaagcgctgcgcgagctgcggctggatctggaagaaggcgccgacatg
gtcatggtcaagccggcgctcccttatctggacgtcatctatcgggtaaagcaggcttct
gatgtgccggtggccgcctaccacgtcagcggcgagtacgccatgctcaaagcggccgcg
ctgaacggctggctcgacgaaaaagccgcggtgctcgaagcgctcacggccatctgtcgc
gccggtgccgacgtgatcctcacctacttcgccaaacaggtagcgcaatggctgcagaag
taa

DBGET integrated database retrieval system