KEGG   Rhodothermus marinus DSM 4252: Rmar_0806Help
Entry
Rmar_0806         CDS       T01119                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rmar_0806
Enzymes [BR:rmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Rmar_0806
Exosome [BR:rmr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rmar_0806
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(924236..925258)
Genome map
AA seq 340 aa AA seqDB search
MEMQTTQSVTLSLIERPRRLRRTEAIRRMVRETRLSVDQLVAPLFVVEGHGVRQEVPSMP
GQYRLSIDELVREARELHALGIPAVALFPALDESLKTPDGREAFNPDGLYPRAIRAVKEA
VPELLVITDVALDPYSSDGHDGIVRDGRILNDETVEILARMAVVQAQAGADIVAPSDMMD
GRVGAIRRALDEAGFTEVAILSYTAKYASAFYGPFRDALDSAPRHRPGVPPDKKTYQMDP
ANAREALRELRLDLEEGADMVMVKPALPYLDVIYRVKQASDVPVAAYHVSGEYAMLKAAA
LNGWLDEKAAVLEALTAICRAGADVILTYFAKQVAQWLQK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgcaaacgacacagagcgtgacgctttcgctgatcgagcgtccccgtcggttg
cgccggaccgaagccatccggcgcatggtgcgcgaaacgcgcctgtcggtggaccagctc
gtagcgccgctgttcgtcgtcgagggccacggcgtgcgccaggaagtgccctcgatgccg
ggccagtaccggctcagcatcgacgaactggtacgggaggcgcgggagctgcacgcgctg
ggcatcccggccgtggcgttgtttccggcgctggacgaatcgctcaagacgcccgacggc
cgcgaggcgttcaacccggacggcctctatccccgggccatccgggcagtcaaggaggcc
gtgcccgagctgctggtcatcaccgacgtggcgctggacccctactcgtcggatggtcac
gacggcatcgtacgcgacggccgcattctcaacgacgagacggtggagatcctggcccgg
atggccgttgtgcaggcgcaggccggcgccgacatcgtggccccctcggacatgatggac
ggccgcgtgggcgccatccgccgggcacttgacgaagccggcttcaccgaagtggcgatt
ctctcctacacggccaaatacgcctcggccttctacgggcccttccgggatgcgctcgac
tcggccccgcgccatcggcccggcgtcccgccggacaagaaaacctaccagatggacccg
gccaacgcccgtgaagcgctgcgcgagctgcggctggatctggaagaaggcgccgacatg
gtcatggtcaagccggcgctcccttatctggacgtcatctatcgggtaaagcaggcttct
gatgtgccggtggccgcctaccacgtcagcggcgagtacgccatgctcaaagcggccgcg
ctgaacggctggctcgacgaaaaagccgcggtgctcgaagcgctcacggccatctgtcgc
gccggtgccgacgtgatcctcacctacttcgccaaacaggtagcgcaatggctgcagaag
taa

DBGET integrated database retrieval system