KEGG   Rhodothermus marinus DSM 4252: Rmar_0820Help
Entry
Rmar_0820         CDS       T01119                                 

Definition
(GenBank) peptidase M42 family protein
Organism
rmr  Rhodothermus marinus DSM 4252
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
935502..936575
Genome map
AA seq 357 aa AA seqDB search
MEATNEAFLLKLLETPSPSGFEQALQRTWAQHVKPWADAVEQDSYGTVWAVKRGRADQPR
LMLEAHADEVGFIVQHISDEGFLHIAPIGGADRALARARRVQVLGSNGPVDGVLGHTAIH
LRDTKDEKVPEWHELFVDVGARNREEVAALGIRVGHPVVLASGPFRLQGRRLVGRALDNR
LGGFILAQVLAALAETPAEATVYAVNAVQEETGGYGARMVAYRLHPDLALVLEVTHATDT
PGLDARRHGLVRLGAGPVLTHGTANHPLLVERLLAVAEAEGIPVQHEASSRRTGTDADDI
FPTRGGIPCALVSVPLRYMHSPVEVVDLDDVAHTVRLLVAFVRSLQPDDRFLPELTA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggaagctacgaacgaagcttttctgctgaaacttctggaaacgcccagtccgtcgggg
tttgaacaggccctgcagcgcacctgggcgcagcacgtgaagccgtgggccgacgccgtc
gagcaggatagctatggcacggtctgggctgtaaagcgcgggcgggccgatcagccacgg
ctgatgctggaggcgcatgccgacgaggtgggcttcatcgtgcagcacatctcagatgag
ggatttctgcacattgcgcccatcggcggagccgatcgggcactggcccgcgcgcgtcgg
gtgcaggtgctgggcagcaacgggccggtggacggcgtgctgggacatacggccatccac
ctgcgcgatacgaaagacgagaaggtgcccgagtggcacgaactgttcgtggacgtgggg
gcccgcaatcgggaggaggtggcggcgctgggcatccgggtagggcatccggtggtgctg
gctagcgggccgtttcggcttcaggggcggcggctggtgggacgtgcgctcgacaatcgg
ctgggcggcttcattctggcccaggtgctggccgcgctggccgaaacgcccgcagaagca
actgtctacgccgtcaacgcggtgcaggaggagacgggcggctatggcgcgcgcatggtg
gcctaccggctgcacccggacctggcgctggtgctggaggtgacgcacgccaccgatacg
cccggcctcgacgcccggcggcatggactcgtccgtctgggagccggacccgtgttgacg
cacggcacggccaaccacccgctattggtcgagcgcctgctggccgtggccgaggccgaa
ggcatccccgtgcagcacgaggcgtcgtcccgacgcaccggcaccgacgccgacgatatc
ttcccgacacgtggtggcattccctgcgcgctggtttcggtgccgctgcgctacatgcac
tcgccggtcgaggtggtcgatctggacgacgtggcccacacggtccggctgctggtggcc
ttcgtgcgcagcctgcagccagacgatcgctttctcccggaactgacggcgtag

DBGET integrated database retrieval system