KEGG   Rhodothermus marinus DSM 4252: Rmar_1002Help
Entry
Rmar_1002         CDS       T01119                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Rmar_1002
Enzymes [BR:rmr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Rmar_1002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1140390..1141934)
Genome map
AA seq 514 aa AA seqDB search
MHGLPRSSGILLHPTSLPGPFGIGDLGPSAYRFVDFLVAAGQRLWQMLPLVPVGLGFSPY
ASPSTFAGNPLLISPERLVEAGLLQADDIASPPDFPEDRVDYDWVIVYKQHLLEKAYATF
EAHPDRVDETDFWLFCEKQAFWLDDYALFMALKEAHGGAVWTEWPTELARRDPGALHHAR
QKLARSFRKHQFWQYLFHRQWMDLRAYCHAHGIRLMGDIPIYVAHDSADVWANPHLFHLD
EHGHPTVVAGVPPDYFSETGQRWGNPLYRWEVSRETDHHWWTQRFAALLEKVDLIRLDHF
RGFAAYWEIPAAEPTAVNGRWVPGPGAEFFETIQHKLGPLPLVAENLGVITPDVTELMER
FGFPGMAVLQFAFDDDATSTFLPHNYIRNLVAYTGTHDNDTIVGWWRGQNKTTLPPEVVA
RAKAYARAYLDLDRKREREIHWTCIRTLMASVAELVVFPMQDVLGLGSEARMNTPGTTGP
HNWSWRLRADQLRPDVAERLRSLTEIYGRLLPAS
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgcacggtcttccccgttccagtggtattctgctccatccgacttcgcttccgggacct
tttggcattggtgatctggggccgtctgcctatcgatttgttgactttctagttgccgcc
ggacagcgtctctggcagatgcttccgctggtgccggttggcctgggtttttctccctat
gccagtccttcaacatttgccggcaatccgctgctgatcagtccggaacgtctggtcgaa
gcaggtctgctgcaggccgacgacattgcctcacctcctgactttcccgaagaccgtgtg
gactacgattgggttattgtctataagcagcatttgctggagaaggcttacgccacattt
gaggcacacccggaccgggtagatgagaccgatttctggcttttctgcgaaaagcaggct
ttctggcttgacgattatgcgctcttcatggcgctcaaagaggcgcacgggggagctgtc
tggaccgaatggcccaccgagctggcccgccgtgatcccggtgccctgcaccacgctcgt
cagaagctggcccgctccttccgaaagcaccagttctggcagtacctttttcacaggcag
tggatggacctgcgggcctattgccatgcacacggcatccggctgatgggcgatatcccg
atctatgtggcacacgacagcgccgacgtgtgggctaatccccacctgtttcatctggac
gaacacggccatcccaccgtggtagccggcgtgcctcccgattacttcagcgaaacgggc
cagcgctggggcaatccgctttaccggtgggaggtctcccgagagacggaccatcactgg
tggactcagcgctttgcggccctgctggaaaaggtggatctgatccgtctggaccacttc
cggggctttgcggcctactgggagattcccgccgcggaacccaccgctgtcaacgggcgc
tgggtacccggtcctggtgctgagttttttgagacaattcagcacaaactcggaccgctt
ccgctcgtcgccgaaaacctcggtgtcattacgcccgacgtcaccgagctcatggaacgc
tttggctttcccggcatggccgtgctccagtttgccttcgacgatgacgccacctccacc
tttctaccacacaactatatccgcaacctcgtagcctacaccggcacgcacgacaacgac
acgatcgtgggctggtggcgtggccagaacaaaaccacccttccgccagaggttgttgct
cgggccaaggcctacgcccgcgcctatctggacctggaccgcaaacgtgagcgcgaaatc
cactggacctgcattcggacgctgatggcctcggtagccgagctggtcgtgtttccgatg
caggacgtactggggctgggtagcgaagcgcgcatgaacactcccggcaccaccggtccc
cataactggtcctggcgtctgcgtgcggaccagctccgcccggacgtagccgagcgtctc
cgttcccttaccgaaatttatggccgactgctgcccgcttcttaa

DBGET integrated database retrieval system