KEGG   Rhodothermus marinus DSM 4252: Rmar_1049Help
Entry
Rmar_1049         CDS       T01119                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rmar_1049
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rmar_1049
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rmar_1049
Enzymes [BR:rmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rmar_1049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1198585..1199793
Genome map
AA seq 402 aa AA seqDB search
MSTAETELLTYEAPDATGHFGPYGGAFVPETLVPALEALKAAYAEARQDPGFWEEYHALL
REYVGRPTPLTFAPRLSEALGGLQIYLKREDLCHTGAHKINNTIGQILLARRMGKTRIIA
ETGAGQHGVATATVCARFGMQCVVYMGAEDVERQHLNVLRMQLLGAEVRPVESGSRTLKD
ATNEAIRDWVTNVHDTFYLIGSVVGPHPYPMLVRDFQRVIGDEVRRQLAERIGRETPDAL
VACVGGGSNAMGLFYPFLNDRHVRMYGVEAAGEGLDRRHAATLTCGRPGILHGAMSYLLQ
DDDGQVQLAHSISAGLDYPGVGPEHAYLKDLGRVTYVTATDEEALEGVRLLARTEGIIPA
LETAHAIAFLPLLARELGPDAVVVVNLSGRGDKDMGTIARYM
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgccgagaccgaactgctgacctacgaggcgccggacgccaccggacacttc
ggcccctacgggggcgcatttgtgcccgagacgctggtgccggcgctggaagcgttgaag
gcggcctacgccgaggcgcgtcaggatccgggcttctgggaggaataccacgccctgctc
cgggaatatgtgggtcggcccacgccgctcacgttcgcaccgcgcctcagcgaagcgctg
ggcgggctgcagatctacctgaagcgggaggacctgtgccacacgggtgcccacaagatc
aacaacacgatcggccagatcctgctggcccggcgcatgggcaagacgcgcatcatcgcc
gagacgggcgccggacagcacggcgtggcgacggccacggtgtgcgcccgctttggaatg
cagtgcgtcgtttacatgggcgccgaagatgtggagcgccagcacctgaacgtgctgcgc
atgcagttgctgggcgccgaggtgcgacccgtcgagagcgggagccgcacgctcaaagac
gccacgaacgaggccatccgcgactgggtgacgaacgtccacgacacgttctacctgatc
ggctcggtggtgggaccgcacccgtacccgatgctcgtgcgcgactttcagcgcgtgatc
ggcgacgaggtgcggcggcaactggccgaacgcatcggccgggagacgcccgacgcactg
gtggcctgcgtgggcggcggctcgaacgccatgggcttgttctatccgttcctgaacgac
cgccatgtgcgcatgtacggcgtggaggcggccggcgaggggcttgaccgccgtcatgcc
gccacgctcacctgcgggcggcccggcatcctgcacggcgccatgagctatctgttgcag
gacgacgacggtcaggtgcagctggcccattccatttcggcggggctggattacccgggg
gtgggtcccgagcatgcctacctgaaggatctggggcgcgtcacctacgtgacggccacc
gacgaggaggcgctggaaggcgtgcggctattggcccgcaccgaagggattattccggcg
ctggaaacggcgcacgccatcgcgtttctgcccctcctggcccgcgagctggggccggac
gccgtcgtggtggtcaacctgtccggccgcggcgacaaagacatgggcaccattgcacgg
tatatgtaa

DBGET integrated database retrieval system