KEGG   Rhodothermus marinus DSM 4252: Rmar_1050Help
Entry
Rmar_1050         CDS       T01119                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rmar_1050
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rmar_1050
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rmar_1050
Enzymes [BR:rmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Rmar_1050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1199936..1200766
Genome map
AA seq 276 aa AA seqDB search
MIDRLQSMFATLRARGEKAMGLFLTNGFPDPESTRPLLEVIDEAGADFIELGMPFSDPLA
EGVPIQRASERALRHGVRLTDAFRTAEWFRARSQTPLLLMGYVNPIYRYGYRAFCRDAAR
AGVDGLILADLPPEESRALDEAAREAGLAMVYLIAPNTPDERIRAIDERATGFVYAVSVT
GLTGSQLPDHAAVEAYLQRARRQVRRNPLLVGFGIKSHEDARRLSRHTDGFIVGSALIRL
VERLWDDPALTPEERLASVRRFVHALKHGTPVQVGT
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatcgcctgcaatcgatgtttgcaacgttgcgggcccgtggtgagaaggccatg
ggcctgtttctgacgaacgggtttccggatccggaaagcacccgcccgctgctggaggtc
atcgacgaggccggcgcggatttcatcgagctgggcatgcccttcagcgatccgctggcc
gaaggcgtgccgatccagcgggccagcgagcgggcgcttcggcacggcgtgcgtctgacc
gacgccttccgcactgccgaatggttccgggcgcggagccagacaccgctgctgctcatg
ggctacgtcaacccgatctatcgctacggctaccgggccttctgccgcgatgccgcccgg
gcgggcgtggacggattgatcttggccgatctgccgccggaagaaagcagggcgctggac
gaagccgcccgcgaggcgggcctggccatggtctatctgatcgccccgaacacgccggac
gaacgcatccgggcgatcgacgagcgcgccaccgggttcgtctatgccgtgtcggtgacc
ggcctgaccgggagccagttgcccgatcatgcggccgtcgaggcctacctgcagcgggcc
cgccgccaggtccggcgtaatcccctgctggtggggtttgggatcaaatcgcacgaagac
gcccggcgcctgagccgccacacggacggcttcatcgtgggctcggcgctgatccggctg
gtcgagcggctctgggacgatccggcgcttacgccggaggagcggctggcgtccgtgcgc
cggttcgtgcatgcgctgaagcacggtacgccggttcaggtgggcacctga

DBGET integrated database retrieval system