KEGG   Rhodothermus marinus DSM 4252: Rmar_1214Help
Entry
Rmar_1214         CDS       T01119                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rmr00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:rmr00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1421029..1422348)
Genome map
AA seq 439 aa AA seqDB search
MDKLVIEGGRPLRGTIPISGSKNTALMLMAGAVLADGVTVLENIPHLRDITTFSHVLRIA
GASVRFDPETHVMRIDATRIDFPEAPYELVKQMRASFYMLGALLGRCGQARVSLPGGCAW
GPRPVNLHLEGLRAFGAEIELDQGYVVARAPGGRLRGGRFRLEPPSVGATVNLLLGAVTA
RGSSRIENAALEPDVVVFGRALQQMGARIEGLGTRTIEVEGVDALQPVTFRNCPDRIELG
TFMIAAAIAGSPGDTIYLTGAEPSHLGEAFLEAFRQTGAAFTFDGDTVAVTVPERLQAVS
IETAPYPGFPTDLQAQWTVLLSQAEGAGFVRDTVYPDRFKHVPELMRMGLQARVEGNTVF
LEGPQRLQGAHVMSTDLRGSVSLVLAGLVAEGETHVLRVYHLDRGYENLEGKLSAAGIAI
RRESYDEFATPTPESAEEN
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggataaactggtcatcgaaggcggccgtccgctccggggcacgatcccgatcagcggc
tcgaagaacacggcgctgatgctgatggccggggccgtgctggccgacggcgtcaccgtg
ctggaaaacattccgcacctgcgcgacatcacgacgttctcgcatgtgctgcgcattgca
ggggcttcggtgcggttcgatccggaaacgcacgtcatgcgcatcgatgccacccgtatc
gactttcccgaggccccttacgagctggtcaagcagatgcgggcgtcgttctacatgctg
ggtgccctgctgggccgctgcggacaggcgcgcgtgtcgctcccaggcggctgcgcctgg
ggtccgcgcccggtcaacctgcacctggagggactgcgcgccttcggggccgagatcgag
ctggaccagggctacgtagtggcccgcgcgcccggcggacgactgcgcggcggccgtttt
cggctcgagccgcccagcgtcggggccacggtcaacctgctgctgggagccgtcacggcc
cgcggcagctcccgcatcgagaacgccgcgctcgaacccgacgtggtcgtcttcggccga
gccctgcaacagatgggcgcccgcatcgaaggactgggcacgcgcaccatcgaagtggaa
ggcgtcgacgcgctgcagcccgtcaccttccgcaactgccccgaccgcatcgagctgggc
acgttcatgattgccgccgccatcgcaggatcgcccggcgacacgatctacctgaccggc
gccgagccgtcccacctgggcgaggcgtttctggaggcctttcgccagaccggcgccgcc
ttcaccttcgatggcgacacggtggccgtcaccgtccccgaacggctgcaggccgtttcg
atcgagacggcaccctatccgggcttcccgaccgatctgcaggcgcagtggaccgttctg
ctctcccaggccgaaggcgccggcttcgtgcgggatacggtctatcctgatcgcttcaag
cacgtccccgaactcatgcgcatggggctgcaggcgcgcgtcgagggcaacacggtcttt
ctggaagggccgcagcgtctgcagggtgcgcacgtgatgagcaccgacctgcgcggcagc
gtttcactggtgctggcgggtctggtggccgaaggcgaaacgcacgtgctgcgcgtctac
cacctcgaccgcggctacgaaaacctcgaaggcaagctctcggccgccggcattgccatc
cgtcgcgaaagctacgacgaattcgccacccccactcccgaatcggccgaggaaaactga

DBGET integrated database retrieval system