KEGG   Rhodothermus marinus DSM 4252: Rmar_1241Help
Entry
Rmar_1241         CDS       T01119                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rmar_1241
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Rmar_1241
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rmar_1241
Enzymes [BR:rmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Rmar_1241
Exosome [BR:rmr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rmar_1241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1450623..1451990
Genome map
AA seq 455 aa AA seqDB search
MRWILLFLVMLLGVGEGARAQSPRPKNLILMIADGCGPASITMARDYARAVLGREELTLD
AIQTGAVRTASASSRVTDSAAGATAYACGVKTYNGAIAVDTAGRPLATLLEAAKARGMAT
GLVATSRISHATPAAFAAHVPQRAMESEIAAQMLAQRVDVLLGGGWSYFLPTAEGGRRQD
GRNLLREAEAMGYQVVRTAADFRRGVRRPVLGLFGPSHLPYEIDRDPEEVPSLAEMTRAA
LELLADDPDGFFLMVEGSRIDHAGHANDAAAHVREVLAYDEAVAVALDFARRDGQTLVVS
VADHETGGLSLGRNVNGRGVYDWHPEVLARVQASYERLIPALRRSERPDSLLQAWLGLDS
LRADEQALVAQATAEPDTWAEVVTELIGRRAVVGWTSNGHTAVDVNLYAFGPGAERLVGS
FENDELGRLLAELMGFDLPALTETLRREEAVGESH
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgcgctggatattgctgtttttggtgatgctgttgggggtcggagaaggggctcgggcc
cagtcgccgcgtccgaagaacctgatcctgatgattgccgacgggtgtggtccggccagc
atcacgatggcccgtgactatgcccgggccgtgctgggacgtgaggaactgacgctggat
gccattcagaccggtgccgtgcgtactgcttcggcctccagccgggtgaccgactcggcc
gccggggcgacggcctatgcctgcggcgtcaagacctacaacggcgcgattgccgtcgat
acggccggacgcccactcgccacgttgctcgaagcggcaaaagcgcgtgggatggcgacc
gggctggtggcgaccagccggatctcacacgccacgccggccgccttcgccgcccatgtg
ccgcagcgcgccatggaaagcgaaatcgccgcgcagatgctggcgcaacgcgtcgatgtg
ctgctggggggtggctggagctatttcctgccgaccgcggagggcggacggagacaggac
ggccgcaatctgctgcgcgaagccgaagcgatgggctaccaggtagtgcgtacggccgcc
gacttccgccggggggtgaggagaccggtgctgggactgttcgggccaagccatctgccc
tacgagattgaccgcgacccggaagaggtcccctcgctggccgagatgacccgcgcggca
ctcgagctgctggcggacgatccggacggcttcttcctgatggtggagggcagccgcatc
gaccacgccggacatgccaacgacgccgccgcccacgtccgcgaagtgctggcttacgat
gaagccgtggccgtggcgctcgactttgcccgccgcgacggacagacgctcgtcgtctcg
gtggccgaccacgagacgggcggtctgtcgctggggcgcaacgtgaacggccgcggcgtc
tacgactggcacccggaagtgctggcccgcgtgcaggcttcctacgaacggcttatcccg
gcactgcgccgttcggagcgacccgactcgctcctgcaggcctggctcgggctcgacagc
ctgcgcgccgacgagcaggcgctcgtcgcgcaggccacggccgaacccgacacctgggcc
gaggtggttaccgagctgatcggtcgccgggccgtggtgggctggacctcgaatggccac
accgctgtggacgtcaatctgtacgccttcggacccggcgccgaacggctggtgggcagc
ttcgagaatgacgaactcggccgcttactggccgaactcatgggtttcgacctgccagcc
ctgaccgagacgctccggcgggaggaagccgtcggcgaaagccactga

DBGET integrated database retrieval system