KEGG   Rhodothermus marinus DSM 4252: Rmar_1263Help
Entry
Rmar_1263         CDS       T01119                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rmar_1263
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rmar_1263
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Rmar_1263
Enzymes [BR:rmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Rmar_1263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1482452..1483762
Genome map
AA seq 436 aa AA seqDB search
MTAPAPIRFVSTRGKAPALTFDEALLQGLASDGGLYIPERVPQLPSTVWRAARSFPEMAA
EVLARWLQGVFPEETVSRVTAEALSFPVPLVPLGDGLYVLELFHGPTLSFKDFGARTMAR
FAREVLRRRDERLLVLVATSGDTGSAVADGFAGLERVQVGLLYPYGQVSPVQERQLIVQR
PGVQAFAVHGTFDDCQRLVKSAFADPDFSRVRLSSANSINVGRLLPQMLYYIWAVAEGGF
DEVVFCVPSGNLGNLTGGVLAALSGLPVRRFIAAHNANDFFPRFLAGEGPAFGPSRRTLS
NAMDVGAPSNFERLQALLGASMPERIWGTSVSDKETLQTIRQVYETTGYLADPHTAVGLE
AARRYREATGDRAPLVVLATAHPAKFPEVIRQALDFEPEAPEALARLWKQEVSVVHVEAD
LEALKAHLLPHVAAGT
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgactgctccggcacccatccgttttgtcagcacgcgcgggaaggcgcctgccctgacg
ttcgacgaagccctgttgcaggggctggcgtctgacggtggcctctacatcccggagcgt
gttccgcaactgccatccaccgtctggcgcgcggcccgctcgtttcccgagatggccgcc
gaggtgctggcgcgctggctgcagggcgtttttccggaggaaacggtgtcccgggtaacg
gccgaggcgctttcgttcccggtaccgctcgtgccgctgggcgacggcctttacgtgctg
gagcttttccacgggccgacgctttcgttcaaggactttggcgcccgtaccatggcccgc
tttgcccgtgaggtgctgcgccggcgagacgagcgcctgctggtgctggtggctacgtcg
ggcgatacgggcagtgccgtggccgatggcttcgccggactggagcgcgtgcaggtaggc
ctgctctatccctacggccaggtcagtcccgtgcaggagcggcagctcatcgtgcagcgg
ccgggcgtgcaggcctttgccgtgcacggcacgttcgacgactgccagcggctggtcaaa
tcggccttcgccgatccggacttttcccgcgtgcggctctcttcggccaactcgatcaac
gtgggacgcctcctgccacagatgctctactacatctgggccgtggccgagggcgggttc
gacgaagtggtcttctgcgtgcccagcggcaacctgggcaacctgaccggcggggtgctg
gccgcactgagcgggttgcccgtgcggcgtttcattgccgcccacaacgcgaacgacttc
ttcccgcgctttctggcgggcgagggaccggccttcgggccatcgcgacgcacgctgtcg
aatgccatggacgtgggtgcgccgagcaacttcgaacggttgcaggcgctgctgggtgcg
tccatgcccgagcgcatctggggcacgagcgtatcggacaaagaaacgctgcagaccatc
cggcaggtgtacgagacgaccggctacctggccgatccgcacacggccgtggggctggag
gcggcccgccgctaccgggaggccacaggtgatcgggcaccactcgtggtgctggctacg
gcccacccggccaagtttcccgaagtgatccgccaggcgctggatttcgaaccggaggcg
cccgaggcgctggcgcggctctggaagcaggaagtttctgtggtgcatgtcgaagccgat
ctggaggccttgaaagcgcacctgttgcctcatgtggctgccgggacgtaa

DBGET integrated database retrieval system