KEGG   Rhodothermus marinus DSM 4252: Rmar_1263Help
Entry
Rmar_1263         CDS       T01119                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rmar_1263
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rmar_1263
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Rmar_1263
Enzymes [BR:rmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Rmar_1263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1482452..1483762
Genome map
AA seq 436 aa AA seqDB search
MTAPAPIRFVSTRGKAPALTFDEALLQGLASDGGLYIPERVPQLPSTVWRAARSFPEMAA
EVLARWLQGVFPEETVSRVTAEALSFPVPLVPLGDGLYVLELFHGPTLSFKDFGARTMAR
FAREVLRRRDERLLVLVATSGDTGSAVADGFAGLERVQVGLLYPYGQVSPVQERQLIVQR
PGVQAFAVHGTFDDCQRLVKSAFADPDFSRVRLSSANSINVGRLLPQMLYYIWAVAEGGF
DEVVFCVPSGNLGNLTGGVLAALSGLPVRRFIAAHNANDFFPRFLAGEGPAFGPSRRTLS
NAMDVGAPSNFERLQALLGASMPERIWGTSVSDKETLQTIRQVYETTGYLADPHTAVGLE
AARRYREATGDRAPLVVLATAHPAKFPEVIRQALDFEPEAPEALARLWKQEVSVVHVEAD
LEALKAHLLPHVAAGT
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgactgctccggcacccatccgttttgtcagcacgcgcgggaaggcgcctgccctgacg
ttcgacgaagccctgttgcaggggctggcgtctgacggtggcctctacatcccggagcgt
gttccgcaactgccatccaccgtctggcgcgcggcccgctcgtttcccgagatggccgcc
gaggtgctggcgcgctggctgcagggcgtttttccggaggaaacggtgtcccgggtaacg
gccgaggcgctttcgttcccggtaccgctcgtgccgctgggcgacggcctttacgtgctg
gagcttttccacgggccgacgctttcgttcaaggactttggcgcccgtaccatggcccgc
tttgcccgtgaggtgctgcgccggcgagacgagcgcctgctggtgctggtggctacgtcg
ggcgatacgggcagtgccgtggccgatggcttcgccggactggagcgcgtgcaggtaggc
ctgctctatccctacggccaggtcagtcccgtgcaggagcggcagctcatcgtgcagcgg
ccgggcgtgcaggcctttgccgtgcacggcacgttcgacgactgccagcggctggtcaaa
tcggccttcgccgatccggacttttcccgcgtgcggctctcttcggccaactcgatcaac
gtgggacgcctcctgccacagatgctctactacatctgggccgtggccgagggcgggttc
gacgaagtggtcttctgcgtgcccagcggcaacctgggcaacctgaccggcggggtgctg
gccgcactgagcgggttgcccgtgcggcgtttcattgccgcccacaacgcgaacgacttc
ttcccgcgctttctggcgggcgagggaccggccttcgggccatcgcgacgcacgctgtcg
aatgccatggacgtgggtgcgccgagcaacttcgaacggttgcaggcgctgctgggtgcg
tccatgcccgagcgcatctggggcacgagcgtatcggacaaagaaacgctgcagaccatc
cggcaggtgtacgagacgaccggctacctggccgatccgcacacggccgtggggctggag
gcggcccgccgctaccgggaggccacaggtgatcgggcaccactcgtggtgctggctacg
gcccacccggccaagtttcccgaagtgatccgccaggcgctggatttcgaaccggaggcg
cccgaggcgctggcgcggctctggaagcaggaagtttctgtggtgcatgtcgaagccgat
ctggaggccttgaaagcgcacctgttgcctcatgtggctgccgggacgtaa

DBGET integrated database retrieval system