KEGG   Rhodothermus marinus DSM 4252: Rmar_1294Help
Entry
Rmar_1294         CDS       T01119                                 

Definition
pyridoxal-phosphate dependent TrpB-like protein
Orthology
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rmr01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:rmr00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:rmr00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1518769..1520142
Genome map
AA seq 457 aa AA seqDB search
MEESVKILLPESELPTHWYNLNADLGALGVELPPVLHPGTKQPVGPADLAPLFPEALIAQ
EVSTERYIEIPEPVRDIYRLWRPTPLFRARRWEKALDTPARIYYKYEGVSPTGSHKPNTA
VPQVYYNAQEGVRRITTETGAGQWGSALSFACQVFGLECKVYMVRVSYEQKPYRRVLMQA
WGAAVVPSPSTETEAGRRVLAEDPDSTGSLGIAISEAVEEAATRNDTKYALGSVLNHVLL
HQTVIGQEVIRQLERAGADWPDVIVGCVGGGSNFAGFAFPFLAERVRSGRTTRIVAVEPT
AAPSLTRGVYAYDFGDTARLTPLVKMYTLGHDFIPAPIHAGGLRYHGMSPQVSALYAAGL
IEARSVPQNPMFAAALSFARSEGIVPAPEAGHAVWGAMQEALAAREAGEARTIVFNLCGH
GHFDLSAYEAYLAGKLEDYEYPEEAVRKSLEALPQID
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggaagaatcggtaaaaatcctgctcccggagtcggagctgcccacccactggtacaat
ctgaatgccgatctgggcgcactgggcgtcgaattgccgcccgtgctgcatcccggcacg
aagcagccggtgggaccggccgatctggccccgctgtttcccgaagcgctcatcgctcag
gaggtgagcaccgaacgctacatcgagattcccgagcccgtgcgcgacatctaccggctc
tggcggcccacgccgctctttcgcgcccgccgctgggaaaaggcgctcgacacgcccgcc
cgcatctactacaagtacgaaggcgtgagtcccacgggtagccacaagcccaacacggcc
gtcccgcaggtctactacaacgcgcaggaaggcgtgcggcgcatcacgacggagaccggc
gccgggcagtggggaagcgcgctgagcttcgcctgtcaggtgttcgggctggagtgcaag
gtgtacatggtgcgcgtgagctacgagcagaagccctatcgtcgcgtgctcatgcaggcc
tggggtgcggcggtggtgccgagcccgagcaccgagacggaagccggccgccgtgtgctg
gccgaagaccccgacagcacgggcagtctgggcatcgccatcagcgaggccgtcgaggaa
gcggccacgcgcaacgacacgaagtacgcgctgggcagtgtgctcaaccacgtgctgctg
caccagacggtcatcgggcaggaggtgatccgccagctcgaacgggccggcgccgactgg
cccgacgtgatcgtcggttgcgtgggcggcgggagcaactttgcaggctttgcctttccg
ttcctggcggaacgcgtgcgctccggccgtacgacgcgcatcgtggccgttgaaccgacg
gctgccccttcgctgacgcggggcgtctatgcctacgatttcggtgacacggcccggctg
acgccgctcgtgaagatgtacacgctcgggcacgacttcatcccggcgcccattcatgcc
ggcggcctgcgctaccacgggatgagtccgcaggtgagcgcgctctatgcggccgggttg
atcgaagcgcggagtgtgccccagaatccgatgtttgcggcggcgctgagctttgcgcgc
agcgaagggatcgtgccggcgccggaagccgggcatgccgtctggggggccatgcaggag
gccctggcggctcgcgaagccggcgaggcgcgcacgatcgtcttcaacctgtgcggccac
ggacacttcgatctgagcgcctacgaggcctatctggccggtaagctcgaagactacgag
tacccggaagaggccgtccgcaagagcctggaggcactgccgcagatcgactga

DBGET integrated database retrieval system