KEGG   Rhodothermus marinus DSM 4252: Rmar_1352Help
Entry
Rmar_1352         CDS       T01119                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3 5-epimerase and related enzymes-like protein
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
rmr00521  Streptomycin biosynthesis
rmr00523  Polyketide sugar unit biosynthesis
rmr01130  Biosynthesis of antibiotics
Module
rmr_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Rmar_1352
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Rmar_1352
Enzymes [BR:rmr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Rmar_1352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom FdtA Cupin_2 Cupin_1
Motif
Other DBs
NCBI-ProteinID: ACY48241
UniProt: D0MID3
Position
1585964..1586437
Genome map
AA seq 157 aa AA seqDB search
MNWKEGPIEGVVIRPLKRYEDARGWLAEFFRQDELDPSVYPVMGYVSLTHPGITRGPHEH
REQTDLFVFFHGHLRLYLWDARPDSPTYSHRQVLDVGEAHPVTALVPPGVVHAYRNVGHT
PALLINCPNRLYAGWGRREPVDEIRHENRPDHPFHMD
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgaactggaaagaaggtccgatcgaaggcgtcgtcatccggccgctcaagcgctacgaa
gacgcccgcgggtggctggccgagttttttcggcaggacgaactggacccgtcggtctat
cccgtcatgggatacgtttcgctgacccatcccggcatcacgcgcggtccgcacgagcat
cgggagcagacggacctgttcgtgtttttccatggtcacctgcggctgtatctgtgggat
gcccggcccgactcgcccacctacagtcaccgacaggtgctcgacgtcggcgaggcccat
ccggtcaccgcgctggtgccgcccggggtggtccacgcctatcgcaacgtcggccacacg
cccgccctgctgatcaactgtccgaatcggctctacgccggatggggccgtcgggagcct
gtcgatgagatccgccacgaaaaccgaccggatcatccctttcacatggactga

DBGET integrated database retrieval system