KEGG   Rhodothermus marinus DSM 4252: Rmar_1352Help
Entry
Rmar_1352         CDS       T01119                                 

Definition
dTDP-4-dehydrorhamnose 3 5-epimerase-like protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:rmr00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:rmr00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1585964..1586437
Genome map
AA seq 157 aa AA seqDB search
MNWKEGPIEGVVIRPLKRYEDARGWLAEFFRQDELDPSVYPVMGYVSLTHPGITRGPHEH
REQTDLFVFFHGHLRLYLWDARPDSPTYSHRQVLDVGEAHPVTALVPPGVVHAYRNVGHT
PALLINCPNRLYAGWGRREPVDEIRHENRPDHPFHMD
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgaactggaaagaaggtccgatcgaaggcgtcgtcatccggccgctcaagcgctacgaa
gacgcccgcgggtggctggccgagttttttcggcaggacgaactggacccgtcggtctat
cccgtcatgggatacgtttcgctgacccatcccggcatcacgcgcggtccgcacgagcat
cgggagcagacggacctgttcgtgtttttccatggtcacctgcggctgtatctgtgggat
gcccggcccgactcgcccacctacagtcaccgacaggtgctcgacgtcggcgaggcccat
ccggtcaccgcgctggtgccgcccggggtggtccacgcctatcgcaacgtcggccacacg
cccgccctgctgatcaactgtccgaatcggctctacgccggatggggccgtcgggagcct
gtcgatgagatccgccacgaaaaccgaccggatcatccctttcacatggactga

DBGET integrated database retrieval system