KEGG   Rhodothermus marinus DSM 4252: Rmar_1400Help
Entry
Rmar_1400         CDS       T01119                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rmr00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:rmr00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:rmr02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1633989..1635365
Genome map
AA seq 458 aa AA seqDB search
MRRCLLFLCGLCGLIGVAVAQVPVRLPETLPVAELLRSGPMNGYATQREVVVWLQTWAPA
QVQLLYREEGQPEDSARITPPYFAGPETDYTVHISVPYLEPGRRYVYDVVLNDTILALPY
QPRFQTQPLWQWRTDPPTFTVATASCFYVNDPPYDRPGQPYGGDFQILTHLTRLRPDVMI
WLGDNTYLREADFGSPTMMSYRYAHTRSHPLLQELLATAHHYAVWDDHDYGPNDADRSYV
LKGAALRIFQQYWANPSYGLPGTPGVFTQFTWGDVDFFLLDDRFYRSPNDAPNDSTKTMW
GEAQLTWLIDALTYSRAPFKIVANGNQILNRSTRFESVAARFPRDYERLLREIVRRGISG
VVFLSGDRHHTELLRYEPESFYPLYEITTSPLTAGPSNVEEDNPLRVEGTLLRERNVVLL
TFSGPRTDRVLTITAYDAQGQERWRHTIRARDLRPPER
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgctgtctgcttttcctctgcgggctctgtgggctcatcggagtcgctgtagcc
caggtgcccgtccggctacccgagacgctccccgtggccgaactgctgcgctcaggtccg
atgaacggctacgccacccagcgcgaagtggtcgtctggctgcagacgtgggcgccggct
caggtgcaactgctctaccgcgaagaggggcagcccgaagacagcgcgcgcatcaccccg
ccgtactttgccggccccgaaacggactacaccgtgcacatctccgtgccctacctggag
ccgggccgccgctacgtttacgacgtggtactcaacgacacgatcctggcgcttccctac
cagccccgcttccagacgcaaccgctctggcaatggcgcaccgatccgcccacgttcacc
gtggccacagcttcctgcttctacgtgaacgatccgccctacgaccgccccggccagccc
tacggcggcgacttccagatcctcacgcacctgacacgcctccgtcccgacgtgatgatc
tggctgggcgacaacacctacctgcgcgaggcggacttcggcagcccgaccatgatgtcc
taccgctacgcgcacacccgcagtcacccactgctccaggaactgctcgctacggcccac
cactacgccgtctgggacgaccacgactacggtcccaacgacgccgaccggagctatgtg
ctcaaaggcgccgcactgcgcatcttccagcagtactgggccaatccgtcctacgggctg
cccggcacacccggcgtcttcacccagttcacctggggcgacgtggatttctttctgctg
gacgaccgcttctaccggagccccaacgacgccccgaacgattccaccaagaccatgtgg
ggcgaggcgcagctcacctggcttatcgacgcgctcacctacagccgcgcccccttcaag
atcgtcgccaacggcaaccagatcctcaaccgctccacccgcttcgagtcggtggccgcc
cgctttccgcgcgattacgagcggctgctccgggaaatcgtacgccgcggcatctccggc
gtggtgtttctgagcggcgaccgtcaccacaccgagctgctgcgctacgagccggaaagc
ttctatccgctctacgagatcaccacttcgccgctgacggcgggtccctcgaacgtggaa
gaagacaatccgctgcgcgtcgaaggtacgctgctgcgcgagcgcaacgtggtgctgctc
accttctccggcccccgcaccgaccgcgtgctgacgatcaccgcctacgacgcacaggga
caggagcgctggcgccacacgatccgggctcgggaccttcgtccgcccgaacggtga

DBGET integrated database retrieval system