KEGG   Rhodothermus marinus DSM 4252: Rmar_1476Help
Entry
Rmar_1476         CDS       T01119                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
rmr00010  Glycolysis / Gluconeogenesis
rmr00051  Fructose and mannose metabolism
rmr00562  Inositol phosphate metabolism
rmr01100  Metabolic pathways
rmr01110  Biosynthesis of secondary metabolites
rmr01120  Microbial metabolism in diverse environments
rmr01130  Biosynthesis of antibiotics
rmr01200  Carbon metabolism
rmr01230  Biosynthesis of amino acids
Module
rmr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
rmr_M00002  Glycolysis, core module involving three-carbon compounds
rmr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rmar_1476
   00051 Fructose and mannose metabolism
    Rmar_1476
   00562 Inositol phosphate metabolism
    Rmar_1476
Enzymes [BR:rmr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rmar_1476
Exosome [BR:rmr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rmar_1476
  Exosomal proteins of bladder cancer cells
   Rmar_1476
  Exosomal proteins of melanoma cells
   Rmar_1476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACY48363
UniProt: D0MIQ5
Position
complement(1720962..1721711)
Genome map
AA seq 249 aa AA seqDB search
MLVAGNWKMHTDREEAIRLAEAVVAEVGDPGSVQVAVCPPFVNLEVVRQIIEGTPIRLGA
QNMHYEEAGAYTGEVSAPMLKSVGCRYVILGHSERRQYFGETDEGVNRKIKRALQYELIP
IVCVGETLEERQAGQAAAVVERQVRAALDGVALHSAEALVIAYEPVWAIGTGHTATPEQA
QEMHALIRRLLIDRYGEAIGRALHILYGGSVKPGNAADLFAQPDVDGGLIGGASLKAADF
AAIVRAAHC
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgctggtagccggtaactggaaaatgcacacggatcgggaggaagccattcggttggcc
gaagccgtcgtcgccgaagtgggcgatcccggttcggtacaggtggccgtgtgtccgccg
ttcgtcaacctggaagtggtgcgtcagatcatcgaaggcacgccgatccggctgggcgcg
cagaacatgcactacgaggaggcgggcgcttacacgggcgaagtatcggcacccatgctg
aagtcggtgggctgtcggtacgtgattctcggccactcggaacggcgccagtacttcggt
gagactgatgagggcgtcaatcgcaagatcaagcgggcccttcagtacgaattgattccg
atcgtctgtgtgggggagacgctcgaagagcgacaggccggccaggcggcggccgtggtg
gaacgtcaggtgcgggcggccctggacggcgtcgcgctgcattcggccgaggcgctggtg
atcgcctacgagccggtctgggccatcgggacgggccacacggccacgccggagcaggcg
caggagatgcacgcgctgattcgtcgcctgctgatcgaccggtacggtgaggccatcggc
cgcgcgctgcacatcctgtacgggggaagcgtcaaaccgggcaatgcggccgatctgttt
gcgcagccggacgtcgacggcggcctgatcggcggggccagcctcaaggccgccgatttt
gcagcgatcgtgcgggccgcccattgctga

DBGET integrated database retrieval system