KEGG   Rhodothermus marinus DSM 4252: Rmar_1499Help
Entry
Rmar_1499         CDS       T01119                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rmar_1499
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rmar_1499
   00620 Pyruvate metabolism
    Rmar_1499
   00640 Propanoate metabolism
    Rmar_1499
  Energy metabolism
   00680 Methane metabolism
    Rmar_1499
Enzymes [BR:rmr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Rmar_1499
Lipid biosynthesis proteins [BR:rmr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Rmar_1499
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1750526..1752511)
Genome map
AA seq 661 aa AA seqDB search
MGVQETIRETAAFSGRGLVFDPPEAFRKRAFISSMEQYRELYERSIKDPEGFWREQAQRI
TWFEPFHTVKNTSYDPSNLYIRWFEGGKLNAAYNCIDRHLEKRADQVAFYWEPDDPNEES
KAITYRQLYEEVCRLANVLKKHGVKKGDRVTIYLPMIPEAIYAMLACARIGAIHSVVFAG
FSPDSLADRILDGEATYLITADEGLRAGRRVPLKRNADKALERCPDVKTVLVVRRTGGDI
PWVEGRDRWYHEEIQTVSAECPPEVMDAEDPLFFLYTSGSTGKPKGVVHTTGGYLVYTSL
THQLVFDYHDGDVYWCAADIGWVTGHSYIVYGPLANGVTEVLFEGTPNYPDPSRIWQVVD
KYQVNILYTSPTAIRALMREGDEWVKKTSRKSLRLLGTVGEPINPEAWLWYYRVVGEERC
PIVDTWWQTETGGIMITPLPGATPLKPGSATLPFFGIQPAIVDNDGNILEGPADGMLVIL
DSWPGQMRTVYRAHDRFVETYFTRFPGKYFTGDGARRDEDGYYWIVGRVDDVINVSGHRL
GTAEIESALVQHEAVAEAAVVGYPHEIKGQGIYAFVTLKAGFEPSDELRKELIQHVRNLL
GPIFTIDLLQFTPALPKTRSGKIMRRILRKIAANEYQDLGDISTLADPSVVEELVQNRLN
R
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgggtgttcaggaaacgatcagagaaacggcggccttctcgggacgcggactggtcttc
gatcctccggaagcgtttcgcaaaagggctttcattagctcgatggagcaatatcgtgag
ctctacgagcgctccatcaaagatccggaaggcttctggcgcgagcaggcccagcgcatc
acctggttcgagccgttccatacggttaaaaacacgtcgtacgacccctcgaatctctat
atccgctggttcgagggcggcaaactgaacgcggcctacaactgcatcgaccgtcatctg
gaaaagcgggccgatcaggtggccttctactgggagccggacgatccgaacgaagagagc
aaggcgatcacctaccgccagctctacgaagaagtctgccggctggccaatgtgctcaaa
aagcacggcgtgaagaaaggcgaccgggtgacgatctacctgcccatgatcccggaagcc
atctacgccatgctggcctgcgcccggatcggggcgatccactcggtggtctttgcgggc
ttttcgcccgactcgctggccgatcgtattctggacggcgaggcgacctacctgatcacg
gccgacgaggggctccgggccgggcgtcgcgtgccgctcaagcggaatgccgataaggcg
ctcgaacgttgcccggacgtgaagaccgtgctggtcgtgcgtcgcacgggcggcgacatc
ccgtgggtggaaggccgcgaccgctggtatcatgaggaaatccagaccgtttcggccgag
tgcccgcccgaggtgatggatgccgaagatccgctcttcttcctctacacctcgggttcg
acaggcaagcccaagggcgtggtgcatacgaccggcggctatctggtctacacctcgctc
acgcaccagctcgtcttcgactatcacgacggcgacgtctactggtgcgcggccgacatc
ggctgggtgacaggccacagctacatcgtctacgggccgctggccaacggcgtgaccgag
gtgcttttcgagggcacgccgaactacccggatccgtcgcgtatctggcaggtggtcgac
aaataccaggtgaacatcctgtacacctcacctacggccatccgggcgttgatgcgcgaa
ggcgacgagtgggtgaagaagacgagccggaagtcgctccggctgctgggcacggtcggg
gagccgatcaacccggaagcctggctctggtactaccgggtggtgggcgaagaacgctgc
ccgatcgtggacacctggtggcagaccgaaacgggcggcatcatgattacgccgctgccg
ggcgccacgccgctcaagccgggctcggccacgctgccgttcttcggtatccagccggcc
atcgtggacaacgacgggaacatcctggaagggccggccgacggcatgctggtcattctc
gattcgtggcccggccagatgcgcacggtctacagggcccatgatcgcttcgtggagacc
tacttcacccgcttcccgggcaagtacttcacgggagacggcgcacgtcgggacgaggac
ggctactactggatcgtgggacgcgtcgacgacgtgatcaacgtctccggtcaccgtctg
ggcacggccgaaatcgaaagcgcgctggtgcagcatgaggcggtggcagaggcggccgtg
gtgggctatccgcacgaaatcaaagggcagggcatctacgccttcgtgacgctgaaggcg
ggcttcgagcccagcgacgaactccgcaaggaattgatccagcacgtgcggaacttgctg
gggccgatcttcacgatcgatctgctccagtttacgccggctttgcccaagacgcgttcc
ggcaagatcatgcgccgcattctgcgcaagattgcggccaacgaatatcaggacctgggg
gatatttcgacgctggccgatccgtcggtcgtcgaagagctggtgcagaatcgactcaac
cgctga

DBGET integrated database retrieval system