KEGG   Rhodothermus marinus DSM 4252: Rmar_1666Help
Entry
Rmar_1666         CDS       T01119                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
rmr  Rhodothermus marinus DSM 4252
Pathway
rmr00860  Porphyrin and chlorophyll metabolism
rmr01100  Metabolic pathways
rmr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rmr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rmar_1666
Enzymes [BR:rmr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Rmar_1666
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Rmar_1666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_2 FAD_oxidored Pyr_redox Pyr_redox_2 Thi4 GIDA HI0933_like FAD_binding_3 AlaDh_PNT_C NAD_binding_9 MCRA FMO-like Prenylcys_lyase Pyr_redox_3 Lycopene_cycl ApbA 3HCDH_N Adeno_terminal
Motif
Other DBs
NCBI-ProteinID: ACY48552
UniProt: D0MJ94
Position
1929944..1931353
Genome map
AA seq 469 aa AA seqDB search
MASVGIIGAGIAGLTAAYELHRRGLEVTVFEATDRIGGFIQSERIDGFLVELGPQTLQRT
SGDFEELLRQVDLEDACIPARPVAANRFIVRGGQPIPLPRSPRELLRTPLLSPRARLRLL
AEPFIHRAHRSTEESVAKFTRRRLGPEVLDYLVEPFVAGIFAGDPEQLSVRYAFPKLFEL
EQQYGSLFWGLIRDRMKQRYHPAPRRSMFSFVEGLHMLPRALAERLPAHAIVRNAEVLAI
RWDEKNPWTLTFRQHGRASTRFFDIIVCAVPLHRLAQLRIHPPVDRRPLSTVEHPPIALV
ALGFRREQVAHPLDGFGMLVPAVERDFQILGTLFSSSLFPDRAPEGHVLLTTFVGGMRHP
ELALLPEDRLEALVLQDLRRLLGISGAPVFRHVWRWERSIPQYRLGYDAVLACVHDVEMS
RSGLFLAGNYMEGISVIDALHTGLKAARAIIQHLREEAAGGLAKLVLGD
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgtgggaatcatcggagccggcattgccggtctgacggccgcctacgaactg
caccgtcgtggcctggaagtgacggtctttgaagccaccgaccgcatcggcggcttcatt
cagtcggagcggatcgacggctttctggtggagctcggtcctcagacgctccagcgcacc
tcgggcgacttcgaagagttgctgcgacaggtggatctggaggacgcgtgcattccggcc
cgaccggtcgcggcgaatcgcttcatcgtgcggggtggccagccgatacccctgccacgc
tcgccgcgcgaactgctgcgcacgccgctgctttcgccccgggcgcgcctgcgcctgctg
gccgagccgttcattcaccgggcccaccggagcaccgaggaaagcgtggccaaattcacc
cggcgtcgactgggtccggaggtgctcgactatctggtagagcccttcgtggccggcatc
tttgcgggcgatcccgagcagctttcggtgcgctacgccttcccgaaactgttcgaactg
gagcagcagtacggctcgcttttctggggcctgatccgcgatcggatgaagcagcggtat
catccggccccgcgccgctcgatgttctcgtttgtcgagggcctgcacatgctgccccgg
gcgctggccgagcggttgcccgcgcacgcgatcgtgcgcaacgcggaggtgctggccatc
cgctgggacgagaaaaacccctggacgctcacgttccggcagcacggccgcgcttcgacc
cgttttttcgatatcatcgtctgtgccgtgccgctacaccggctggcgcaactccggatt
catcccccggtggatcgccggccgctcagcaccgtcgagcacccgcccattgcgctggtg
gcgctgggcttccggcgcgagcaggtggcccatccgctggacggcttcgggatgctggta
ccggccgtggagcgcgactttcagattctgggcacgctgttctcctcgtcgctctttccg
gaccgggcgcccgaaggccacgtgctgctgaccacgttcgtcggcggcatgcggcatccc
gaactggcgttgctgcccgaagatcggctggaggcgctggtgctgcaggacctgcgccgg
ctgctgggcatctcgggcgcgccggtcttccggcacgtgtggcgctgggagcgctcgatc
ccgcagtaccggctgggctacgatgcggtgctcgcctgcgttcacgatgtggaaatgagc
cgctccggtctgtttctggccggcaactacatggaaggcatctccgtgatcgacgcgctc
cataccggcctgaaggccgcccgcgcgatcatccagcacctgcgcgaagaagcagccggc
ggtctggccaagctggtgctgggagattga

DBGET integrated database retrieval system